Crystal Structure of Ebola Envelope glycoprotein GP in complex with compound LD4-189ZbR. Determined by X-ray diffraction at 2.59 Å resolution. Released 30 Jul 2025.
Explore 9NNU in 3D Show helices and sheets RCSB PDB PDBe
9NNU contains 13 α-helices and 29 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 36-39 | 4 | 1 |
| β-strand | 42-45 | 4 | 1 |
| α-helix | 48-50 | 3 | |
| α-helix | 60-62 | 3 | |
| β-strand | 63-69 | 7 | 1 |
| α-helix | 70-73 | 4 | |
| α-helix | 79-84 | 6 | |
| β-strand | 86-89 | 4 | 2 |
| β-strand | 96-98 | 3 | 1 |
| β-strand | 101 | 1 | 1 |
| β-strand | 102-103 | 2 | 3 |
| β-strand | 105-114 | 10 | 4 |
| β-strand | 120 | 1 | 4 |
| α-helix | 123 | 1 | |
| β-strand | 124 | 1 | 5 |
| α-helix | 125-126 | 2 | |
| β-strand | 135-144 | 10 | 4 |
| β-strand | 151-154 | 4 | 2 |
| β-strand | 159-161 | 3 | 1 |
| β-strand | 165-167 | 3 | 1 |
| β-strand | 169 | 1 | 2 |
| β-strand | 172 | 1 | 5 |
| β-strand | 176 | 1 | 4 |
| β-strand | 177-185 | 9 | 1 |
| α-helix | 186-187 | 2 | |
| β-strand | 216-223 | 8 | 4 |
| β-strand | 231-235 | 5 | 4 |
| β-strand | 240-243 | 4 | 4 |
| α-helix | 250-263 | 14 | |
| β-strand | 273-275 | 3 | 4 |
| β-strand | 277 | 1 | 6 |
| β-strand | 308-310 | 3 | 6 |
| β-strand | 474-476 | 3 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 503 | 1 | 1 |
| β-strand | 515-520 | 6 | 3 |
| α-helix | 539-541 | 3 | |
| β-strand | 543-548 | 6 | 3 |
| α-helix | 551-553 | 3 | |
| α-helix | 554-575 | 22 | |
| β-strand | 580-581 | 2 | 1 |
| α-helix | 584-597 | 14 | |
| α-helix | 613-619 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Envelope glycoprotein | A | protein | 470 | Ebola virus - Mayinga, Zaire, 1976 | Q05320 (AlphaFold model) |
| GP2 | B | protein | 168 | Ebola virus - Mayinga, Zaire, 1976 | Q05320 (AlphaFold model) |
>9NNU_1 Envelope glycoprotein (chains A) SIPLGVIHNSALQVSDVDKLVCRDKLSSTNQLRSVGLNLEGNGVATDVPSATKRWGFRSG VPPKVVNYEAGEWAENCYNLEIKKPDGSECLPAAPDGIRGFPRCRYVHKVSGTGPCAGDF AFHKEGAFFLYDRLASTVIYRGTTFAEGVVAFLILPQAKKDFFSSHPLREPVNATEDPSS GYYSTTIRYQATGFGTNETEYLFEVDNLTYVQLESRFTPQFLLQLNETIYTSGKRSNTTG KLIWKVNPEIDTTIGEWAFWETKKNLTRKIRSEELSFTVVSNGAKNISGQSPARTSSDPG TNTTTEDHKIMASENSSAMVQVHSQGREAAVSHLTTLATISTSPQSLTTKPGPDNSTHNT PVYKLDISEATQVEQHHRRTDNDSTASDTPSATTAAGPPKAENTNTSKSTDFLDPATTTS PQNHSETAGNNNTHHQDTGEESASSGKLGLITNTIAGVAGLITGGRRTRR
>9NNU_2 GP2 (chains B) EAIVNAQPKCNPNLHYWTTQDEGAAIGLAWIPYFGPAAEGIYIEGLMHNQDGLICGLRQL ANETTQALQLFLRATTELRTFSILNRKAIDFLLQRWGGTCHILGPDCCIEPADWTKNITD KIDQIIHDFVDGSGYIPEAPRDGQAYVRKDGEWVLLSTFLGTHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 4 |
| A1BZF | N-{3-[(1Z)-1-{4-[2-(dimethylamino)ethoxy]phenyl}-1-phenylbut-1-en-2-yl]phenyl}-… | C30 H37 N3 O4 S | 1 |
SuFEx-enabled high-throughput medicinal chemistry for developing potent tamoxifen analogs as Ebola virus entry inhibitors. Dada, L., Nagai, E., Agrawal, S. et al. Front Immunol (2025) 16:1533037-1533037. DOI 10.3389/fimmu.2025.1533037 · PubMed
Other PDB entries of the same protein (UniProt Q05320 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9NNU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.