9NTQ: Glypican-3

Identification and non-clinical characterization of SAR444200, a novel anti-GPC3 T-cell engager, for the treatment of GPC3+ solid tumors. Determined by electron microscopy at 4.04 Å resolution. Released 15 Oct 2025.

Method: Electron microscopy
Resolution: 4.04 Å
Organisms: Homo sapiens, Lama glama
Chains: 2
Atoms: 3,647
Mol. weight: 63.79 kDa
Ligands: NAG
Released: 15 Oct 2025

Explore 9NTQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9NTQ contains 26 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	75-113	39
α-helix	116-133	18
α-helix	135-137	3
α-helix	140-156	17
α-helix	163-177	15
α-helix	178-183	6
α-helix	195-204	10
α-helix	211-226	16
α-helix	231-243	13
α-helix	250-260	11
α-helix	262-265	4
β-strand	273	1	1
β-strand	274	1	2
α-helix	275-285	11
α-helix	287-290	4
α-helix	292-297	6
α-helix	301-306	6
α-helix	316-321	6
α-helix	323-328	6
α-helix	332-335	4
α-helix	338-348	11
α-helix	384-396	13
α-helix	405-411	7
β-strand	416	1	2
β-strand	420-423	4	1
β-strand	428-431	4	1
α-helix	457-465	9

Chain B: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	3
β-strand	10-12	3	4
β-strand	18-25	8	3
α-helix	33-35	3
β-strand	38-43	6	4
β-strand	50-55	6	4
α-helix	56-58	3
β-strand	65-67	3	4
α-helix	69-71	3
β-strand	75-80	6	3
β-strand	85-90	6	3
α-helix	95-97	3
β-strand	99-105	7	4
β-strand	109	1	4
β-strand	113-117	5	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glypican-3	A	protein	443	Homo sapiens	P51654 (AlphaFold model)
A0226015A08	B	protein	119	Lama glama

Sequence of entity 1 (A), FASTA

>9NTQ_1 Glypican-3 (chains A)
CHQVRSFFQRLQPGLKWVPETPVPGSDLQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQ
SASMELKFLIIQNAAVFQEAFEIVVRHAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSL
YILGSDINVDDMVNELFDSLFPVIYTQLMNPGLPDSALDINECLRGARRDLKVFGNFPKL
IMTQVSKSLQVTRIFLQALNLGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPC
GGYCNVVMQGCMAGVVEIDKYWREYILSLEELVNGMYRIYDMENVLLGLFSTIHDSIQYV
QKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVLKVAHVEHEETLSSRRRELIQK
LKSFISFYSALPGYICSHSPVAENDTLCWNGQELVERYSQKAARNGMKNQFNLHELKMKG
PEPVVSQIIDKLKHINQLLRTMS

Sequence of entity 2 (B), FASTA

>9NTQ_2 A0226015A08 (chains B)
DVQLVESGGGLVQPGGSLRLSCVASGSXFRSVFSSSTMEWYRQPPGKKRELVARIAPGDG
TNYGALYADSVKGRFTISRDDAKKTVDLQMNSLKPEDTGVYFCASGVAWGQGTLVTVSS

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

Identification and Nonclinical Characterization of SAR444200, a Novel Anti-GPC3 NANOBODY T-cell Engager, for the Treatment of GPC3+ Solid Tumors. Meoni, P., Vintem, A.P.B., Cortez-Retamozo, V.F. et al. Mol Cancer Ther (2026) 25:361-370. DOI 10.1158/1535-7163.MCT-24-1049 · PubMed

Other PDB entries of the same protein (UniProt P51654 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7ZAW 2.58 Å, GPC3-Unc5D octamer structure and role in cell migration
7ZA1 4.1 Å, GPC3-Unc5D octamer structure and role in cell migration
9NTT 7.45 Å, Identification and non-clinical characterization of SAR444200, a novel anti-GPC3 T-cell…

Browse structure collections

About this viewer

MolViewer shows 9NTQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.