9P99: Integrin alphaEbeta7

CryoEM structure of integrin alphaEbeta7 bound to E-cadherin. Determined by electron microscopy at 3.37 Å resolution. Released 24 Sept 2025.

Method: Electron microscopy
Resolution: 3.37 Å
Organism: Homo sapiens
Chains: 3
Atoms: 9,790
Mol. weight: 253.72 kDa
Ligands: MN, CA, NAG
Released: 24 Sept 2025

Explore 9P99 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9P99 contains 40 α-helices and 108 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 69 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	1
β-strand	9-10	2	2
α-helix	11-12	2
β-strand	21-26	6	3
β-strand	33-38	6	3
β-strand	49-55	7	3
β-strand	58-63	6	3
α-helix	68-70	3
β-strand	77-82	6	4
β-strand	85-94	10	4
β-strand	99	1	5
β-strand	103-111	9	4
β-strand	117-122	6	4
α-helix	126-129	4
β-strand	130	1	6
α-helix	135-137	3
β-strand	183-189	7	7
α-helix	197-217	21
β-strand	221-227	7	7
β-strand	229	1	8
β-strand	233-236	4	7
α-helix	240-242	3
α-helix	244-251	8
β-strand	261	1	8
α-helix	263-273	11
α-helix	277-279	3
β-strand	286-293	8	7
α-helix	304-308	5
β-strand	316	1	7
β-strand	319-322	4	7
α-helix	330-339	10
β-strand	350	1	7
α-helix	354-357	4
α-helix	360-363	4
β-strand	367	1	5
β-strand	369	1	9
β-strand	377	1	9
β-strand	390-392	3	6
β-strand	397-401	5	6
α-helix	405-408	4
β-strand	410	1	10
β-strand	412-416	5	6
β-strand	421-424	4	6
β-strand	427	1	11
α-helix	436-438	3
β-strand	443	1	10
β-strand	446-448	3	11
β-strand	451	1	12
β-strand	456	1	12
β-strand	459-462	4	11
α-helix	465-467	3
β-strand	470-477	8	11
β-strand	480-488	9	11
β-strand	500-503	4	13
β-strand	513-518	6	13
β-strand	528	1	14
β-strand	529-535	7	13
β-strand	542-548	7	13
β-strand	559	1	14
β-strand	563-565	3	15
β-strand	577-581	5	15
β-strand	594-595	2	16
β-strand	596-600	5	15
β-strand	602-603	2	17
β-strand	606-607	2	17
β-strand	613-616	4	15
α-helix	617-619	3
β-strand	625-627	3	16
β-strand	630-635	6	2
β-strand	644-648	5	2
β-strand	653-656	4	2
β-strand	658	1	1
β-strand	661-662	2	18
β-strand	664-671	8	19
β-strand	675	1	20
β-strand	683-691	9	19
α-helix	696-701	6
β-strand	706-713	8	21
β-strand	722	1	22
α-helix	727-730	4
β-strand	733-736	4	21
β-strand	742-745	4	19
β-strand	748-749	2	19
β-strand	751	1	22
α-helix	752	1
α-helix	756-757	2
β-strand	765-774	10	21
α-helix	783-784	2
β-strand	786-787	2	18
β-strand	794-799	6	21
β-strand	801	1	20

Chain B: 16 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	83-86	4	23
β-strand	94	1	24
β-strand	101	1	24
β-strand	104	1	25
β-strand	108-112	5	23
β-strand	114	1	26
β-strand	115	1	25
β-strand	117	1	26
β-strand	119-126	8	25
α-helix	130-132	3
β-strand	133-140	8	27
α-helix	143-145	3
α-helix	149-166	18
β-strand	170-177	8	27
α-helix	190-194	5
β-strand	204	1	28
β-strand	211-217	7	27
α-helix	220-227	8
β-strand	232	1	28
β-strand	240	1	29
α-helix	243-251	9
α-helix	253-256	4
β-strand	263-269	7	27
β-strand	273	1	29
α-helix	278-282	5
α-helix	287-288	2
β-strand	299	1	27
α-helix	301-305	5
α-helix	307-310	4
α-helix	311-321	11
β-strand	323-329	7	27
α-helix	334-343	10
β-strand	348-351	4	27
α-helix	358-367	10
β-strand	372-375	4	30
β-strand	376-378	3	23
α-helix	379-382	4
β-strand	385-392	8	25
β-strand	398	1	25
α-helix	403-407	5
β-strand	408-412	5	30
β-strand	417-426	10	25
β-strand	433-440	8	23
β-strand	446-452	7	23

Chain C: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	31
β-strand	8	1	32
β-strand	19-23	5	33
β-strand	25	1	31
α-helix	28-31	4
β-strand	35-39	5	34
β-strand	51-53	3	33
β-strand	59-62	4	33
α-helix	68-70	3
β-strand	73-75	3	32
β-strand	77-81	5	34
β-strand	87	1	34
β-strand	95-97	3	32

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrin alpha-E	A	protein	1176	Homo sapiens	P38570 (AlphaFold model)
Integrin beta-7	B	protein	776	Homo sapiens	P26010 (AlphaFold model)
Cadherin-1	C	protein	331	Homo sapiens	P12830 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9P99_1 Integrin alpha-E (chains A)
MWLFHTLLCIASLALLAAFNVDVARPWLTPKGGAPFVLSSLLHQDPSTNQTWLLVTSPRT
KRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLSS
ELTGTCSLLGPDLRPQAQANFFDLENLLDPDARVDTGDCYSNKEGGGEDDVNTARQRRAL
EKEEEEDKEEEEDEEEEEAGTEIAIILDGSGSIDPPDFQRAKDFISNMMRNFYEKCFECN
FALVQYGGVIQTEFDLRDSQDVMASLARVQNITQVGSVTKTASAMQHVLDSIFTSSHGSR
RKASKVMVVLTDGGIFEDPLNLTTVINSPKMQGVERFAIGVGEEFKSARTARELNLIASD
PDETHAFKVTNYMALDGLLSKLRYNIISMEGTVGDALHYQLAQIGFSAQILDERQVLLGA
VGAFDWSGGALLYDTRSRRGRFLNQTAAAAADAEAAQYSYLGYAVAVLHKTCSLSYIAGA
PRYKHHGAVFELQKEGREASFLPVLEGEQMGSYFGSELCPVDIDMDGSTDFLLVAAPFYH
VHGEEGRVYVYRLSEQDGSFSLARILSGHPGFTNARFGFAMAAMGDLSQDKLTDVAIGAP
LEGFGADDGASFGSVYIYNGHWDGLSASPSQRIRASTVAPGLQYFGMSMAGGFDISGDGL
ADITVGTLGQAVVFRSRPVVRLKVSMAFTPSALPIGFNGVVNVRLCFEISSVTTASESGL
REALLNFTLDVDVGKQRRRLQCSDVRSCLGCLREWSSGSQLCEDLLLMPTEGELCEEDCF
SNASVKVSYQLQTPEGQTDHPQPILDRYTEPFAIFQLPYEKACKNKLFCVAELQLATTVS
QQELVVGLTKELTLNINLTNSGEDSYMTSMALNYPRNLQLKRMQKPPSPNIQCDDPQPVA
SVLIMNCRIGHPVLKRSSAHVSVVWQLEENAFPNRTADITVTVTNSNERRSLANETHTLQ
FRHGFVAVLSKPSIMYVNTGQGLSHHKEFLFHVHGENLFGAEYQLQICVPTKLRGLQVVA
VKKLTRTQASTVCTWSQERACAYSSVQHVEEWHSVSCVIASDKENVTVAAEISWDHSEEL
LKDVTELQILGEISFNKSLYEGLNAENHRTKITVVFLKDEKYHGTGGLEVLFQGPGENAQ
CEKELQALEKENAQLEWELQALEKELAQWSHPQFEK

Sequence of entity 2 (B), FASTA

>9P99_2 Integrin beta-7 (chains B)
MVALPMVLVLLLVLSRGESELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPS
CAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGA
TQLAPQRVRVTLRPGEPQQLQVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
RLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRLERCQSPFSFHHVLSLTGDAQ
AFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTSAALPVYQELS
KLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSSLPPGVHISYESQCEGPEKREG
KAEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSD
TQPQAPHCSDGQGHLQCGVCSCAPGRLGRLCECSVAELSSPDLESGCRAPNGTGPLCSGK
GHCQCGRCSCSGQSSGHLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSG
DMDSCISPEGGLCSGHGRCKCNRCQCLDGYYGALCDQCPGCKTPCERHRDCAECGAFRTG
PLATNCSTACAHTNVTLALAPILDDGWCKERTLDNQLFFFLVEDDARGTVVLRVRPQEKG
ADHDTSGLEVLFQGPGKNAQCKKKLQALKKKNAQLKWKLQALKKKLAQGGHHHHHH

Sequence of entity 3 (C), FASTA

>9P99_3 Cadherin-1 (chains C)
MASMHHHHHHGSSMASMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTP
LRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGDWVIPP
ISCPENEKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPL
DRERIATYTLFSHAVSSNGNAVEDPMEILITVTDQNDNKPEFTQEVFKGSVMEGALPGTS
VMEVTATDADDDVNTYNAAIAYTILSQDPELPDKNMFTINRNTGVISVVTTGLDRESFPT
YTLVVQAADLQGEGLSTTATAVITVTDTNDN

Ligands and cofactors

ID	Name	Formula	Copies
MN	Manganese (II) ion	Mn	4
CA	Calcium ion	Ca	3
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3

Primary citation

Molecular exaptation by the integrin alpha I domain. Hollis, J.A., Chan, M.C., Malik, H.S. et al. Sci Adv (2025) 11:eadx9567-eadx9567. DOI 10.1126/sciadv.adx9567 · PubMed

Other PDB entries of the same protein (UniProt P38570 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8ZJF 2.7 Å, Cryo-EM structure of human integrin alpha-E beta-7
9P97 2.92 Å, CryoEM structure of the closed integrin alphaEbeta7 bound to fab LF61
9P98 2.93 Å, CryoEM structure of the open integrin alphaEbeta7 bound to fab LF61

Browse structure collections

About this viewer

MolViewer shows 9P99 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.