Crystal structure of maltose binding protein (Apo), mutant Trp10 to 4-Fluorotryptophan. Determined by X-ray diffraction at 1.87 Å resolution. Released 5 Aug 2026.
Explore 9PQK in 3D Show helices and sheets RCSB PDB PDBe
9PQK contains 24 α-helices and 24 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-3 | 2 | |
| β-strand | 6-10 | 5 | 1 |
| α-helix | 17-31 | 15 | |
| β-strand | 34-38 | 5 | 1 |
| α-helix | 43-51 | 9 | |
| β-strand | 59-63 | 5 | 1 |
| α-helix | 64-66 | 3 | |
| α-helix | 67-72 | 6 | |
| β-strand | 76 | 1 | 2 |
| α-helix | 77-79 | 3 | |
| α-helix | 83-87 | 5 | |
| β-strand | 89 | 1 | 3 |
| α-helix | 91-95 | 5 | |
| β-strand | 98-99 | 2 | 4 |
| β-strand | 102-103 | 2 | 4 |
| β-strand | 106-111 | 6 | 1 |
| β-strand | 114-118 | 5 | 5 |
| β-strand | 128 | 1 | 6 |
| α-helix | 129-131 | 3 | |
| α-helix | 132-140 | 9 | |
| β-strand | 145-147 | 3 | 5 |
| α-helix | 154-161 | 8 | |
| β-strand | 167-172 | 6 | 7 |
| β-strand | 175-182 | 8 | 7 |
| α-helix | 186-200 | 15 | |
| α-helix | 210-218 | 9 | |
| β-strand | 222-227 | 6 | 5 |
| α-helix | 229-234 | 6 | |
| β-strand | 242-245 | 4 | 5 |
| α-helix | 246-248 | 3 | |
| β-strand | 249 | 1 | 6 |
| β-strand | 250 | 1 | 8 |
| β-strand | 253 | 1 | 8 |
| α-helix | 254-255 | 2 | |
| β-strand | 258-259 | 2 | 9 |
| β-strand | 260-266 | 7 | 1 |
| β-strand | 267 | 1 | 2 |
| α-helix | 273-279 | 7 | |
| α-helix | 280-284 | 5 | |
| α-helix | 287-296 | 10 | |
| β-strand | 301-302 | 2 | 1 |
| β-strand | 304 | 1 | 3 |
| α-helix | 305-311 | 7 | |
| α-helix | 315-326 | 12 | |
| β-strand | 328-329 | 2 | 9 |
| α-helix | 330-331 | 2 | |
| α-helix | 336-352 | 17 | |
| α-helix | 357-369 | 13 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Maltose/maltodextrin-binding periplasmic protein | A | protein | 370 | Escherichia coli | P0AEY0 (AlphaFold model) |
>9PQK_1 Maltose/maltodextrin-binding periplasmic protein (chains A) KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDII FWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKD LLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKD VGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKV NYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLG AVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQAVDEA LKDAQTRITK
| ID | Name | Formula | Copies |
|---|---|---|---|
| CD | Cadmium ion | Cd | 4 |
Water and common crystallization additives (NA, EDO) are not listed.
Structural accomodations of tryptophan 4-substitutions in maltose binding protein. Habel, E., Huber, T. To be published.
Other PDB entries of the same protein (UniProt P0AEY0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9PQK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.