9Q4D: Transcription factor ETV6,DARPin

A DARPin fused to the double trigger 1TEL variant crystallization chaperone via a direct helical fusion. Determined by X-ray diffraction at 1.3 Å resolution. Released 1 Oct 2025.

Method: X-ray diffraction
Resolution: 1.3 Å
Organisms: Homo sapiens, synthetic construct
Chains: 1
Atoms: 1,944
Mol. weight: 27.71 kDa
Released: 1 Oct 2025

Explore 9Q4D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9Q4D contains 16 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 0 β-strands

Element	Residues	Length
α-helix	17-19	3
α-helix	23-25	3
α-helix	28-42	15
α-helix	44-46	3
α-helix	56-59	4
α-helix	64-70	7
α-helix	75-97	23
α-helix	100-108	9
α-helix	123-130	8
α-helix	133-141	9
α-helix	156-163	8
α-helix	166-174	9
α-helix	189-195	7
α-helix	199-207	9
α-helix	222-228	7
α-helix	232-239	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor ETV6,DARPin	A	protein	243	Homo sapiens, synthetic construct	P41212 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9Q4D_1 Transcription factor ETV6,DARPin (chains A)
MGHHHHHHHHHHSIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKAL
LELTKEDFRYRSPHSGDELYELLQHILLGKKLLEAARAGQDDEVRILMANGADVNATDND
GYTPLHLAASNGHLEIVEVLLKNGADVNASDLTGITPLHAAAATGHLEIVEVLLKHGADV
NAYDNDGHTPLHLAAKYGHLEIVEVLLKHGADVNAQDKFGKTAFDISIDNGNEDLAEILQ
KLN

Primary citation

Opening Doors in Protein Crystallization: TELSAM Fusions with Two pH Triggers. Averret, J.C., Bradford, M.J., Wilson, E.W. et al. To be published.

Other PDB entries of the same protein (UniProt P41212 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9DOC 1.19 Å, The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly…
9ZB7 1.24 Å, A DARPin fused to the 1TEL crystallization chaperone via a direct helical fusion
7TW9 1.41 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to Sinefungin
1JI7 1.45 Å, Crystal Structure of TEL SAM Polymer
7TDY 1.53 Å, The ubiquitin-associated domain of human thirty-eight negative kinase 1, flexibly fused…
7TW8 1.55 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SAH
8FRJ 1.57 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SGC0946
9DB5 1.57 Å, A DARPin fused to the 1TEL crystallization chaperone via a proline-alanine linker
8FT8 1.6 Å, The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly…
8FRK 1.61 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SGC8158
7TW7 1.62 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SAM
8THA 1.68 Å, 1TEL, non-compressed, double-helical crystal form

Browse structure collections

About this viewer

MolViewer shows 9Q4D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.