9QA5: N-SH2 domain of SHP2

Structure of the N-SH2 domain of SHP2 in complex with the phosphoY627-Gab1 (613-651) peptide. Determined by X-ray diffraction at 2.08 Å resolution. Released 31 Dec 2025.

Method: X-ray diffraction
Resolution: 2.08 Å
Organism: Homo sapiens
Chains: 2
Atoms: 921
Mol. weight: 16.23 kDa
Released: 31 Dec 2025

Explore 9QA5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9QA5 contains 2 α-helices and 13 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	7	1	1
α-helix	13-23	11
β-strand	28-33	6	1
β-strand	41-47	7	1
β-strand	50-56	7	1
β-strand	57-58	2	2
β-strand	63-64	2	2
β-strand	71	1	2
α-helix	74-83	10
β-strand	89	1	3
β-strand	90	1	4
β-strand	95	1	3
β-strand	100-101	2	1

Chain B: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	1
β-strand	8	1	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform 3 of Tyrosine-protein phosphatase non-receptor type 11	A	protein	106	Homo sapiens	Q06124 (AlphaFold model)
GRB2-associated-binding protein 1	B	protein	39	Homo sapiens	Q13480 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9QA5_1 Isoform 3 of Tyrosine-protein phosphatase non-receptor type 11 (chains A)
MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG
DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCAD

Sequence of entity 2 (B), FASTA

>9QA5_2 GRB2-associated-binding protein 1 (chains B)
SSPMIKPKGDKQVEYLDLDLDSGKSTPPRKQKSSGSGSS

Primary citation

Mechanism of SHP2 activation by bis-Tyr-phosphorylated Gab1. Machner, L., Shaikhqasem, A., Gruber, T. et al. Structure (2026) 34:441-453.e7. DOI 10.1016/j.str.2025.11.018 · PubMed

Other PDB entries of the same protein (UniProt Q06124 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9EIK 1.25 Å, Crystal structure of N-SH2 domain of SHP2 with T42A mutation bound to GAB1 tyrosine…
3ZM1 1.4 Å, Catalytic domain of human SHP2
4JMG 1.4 Å, Crystal structure of the synthetic protein in complex with pY peptide
7PPM 1.48 Å, SHP2 catalytic domain in complex with IRS1 (889-901) phosphopeptide (pSer-892, pTyr-896)
3ZM0 1.5 Å, Catalytic domain of human SHP2
3ZM2 1.5 Å, Catalytic domain of human SHP2
3ZM3 1.5 Å, Catalytic domain of human SHP2
7PPL 1.53 Å, SHP2 catalytic domain in complex with IRS1 (625-639) phosphopeptide (pTyr-632, pSer-636)
9EIC 1.58 Å, Crystal structure of unbound N-SH2 domain of SHP2 with T42A mutation
9EHD 1.59 Å, Crystal structure of N-SH2 domain of SHP2 bound to GAB1 tyrosine phosphorylated peptide…
3B7O 1.6 Å, Crystal structure of the human tyrosine phosphatase SHP2 (PTPN11) with an accessible…
4RDD 1.6 Å, Co-crystal structure of SHP2 in complex with a Cefsulodin derivative

Browse structure collections

About this viewer

MolViewer shows 9QA5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.