9QAW: Human LRP2 receptor ectodomain

CryoEM structure of the human LRP2 receptor ectodomain in complex with LRPAP1. Determined by electron microscopy at 3.34 Å resolution. Released 11 Mar 2026.

Method: Electron microscopy
Resolution: 3.34 Å
Organism: Homo sapiens
Chains: 12
Atoms: 63,458
Mol. weight: 1106.85 kDa
Ligands: NAG, BMA, NGA, CA
Released: 11 Mar 2026

Explore 9QAW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9QAW contains 153 α-helices and 597 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 77 helices, 297 β-strands

Element	Residues	Length	Sheet
β-strand	32-33	2	1
α-helix	36-38	3
β-strand	41-42	2	1
α-helix	43-45	3
α-helix	57-59	3
α-helix	212-214	3
β-strand	226-228	3	2
β-strand	234-236	3	2
α-helix	237-239	3
α-helix	251-253	3
α-helix	310-314	5
β-strand	320	1	3
α-helix	325-327	3
β-strand	331	1	3
β-strand	337-339	3	4
β-strand	346-348	3	4
β-strand	362-363	2	5
β-strand	370-371	2	5
β-strand	377-380	4	6
β-strand	384-387	4	6
α-helix	392-394	3
β-strand	395-399	5	7
β-strand	404-408	5	7
β-strand	414-418	5	7
β-strand	426-432	7	8
β-strand	437-442	6	8
β-strand	447-452	6	8
β-strand	458-462	5	8
β-strand	469-475	7	9
β-strand	480-485	6	9
β-strand	490-495	6	9
β-strand	502-505	4	9
β-strand	514-518	5	10
β-strand	523-528	6	10
β-strand	537-541	5	10
β-strand	549-552	4	10
β-strand	559-565	7	11
β-strand	570-575	6	11
β-strand	580-584	5	11
β-strand	592-596	5	11
β-strand	604-610	7	12
β-strand	613-618	6	12
β-strand	623-628	6	12
β-strand	636-640	5	12
α-helix	644-645	2
β-strand	648-651	4	7
α-helix	653-655	3
α-helix	666-669	4
β-strand	673-676	4	13
β-strand	687-690	4	13
β-strand	695-697	3	14
β-strand	704-706	3	14
β-strand	709-715	7	15
β-strand	719-722	4	15
α-helix	734-735	2
β-strand	736	1	15
β-strand	746-749	4	16
β-strand	754-759	6	16
β-strand	764-769	6	16
β-strand	776-779	4	16
β-strand	789-792	4	17
β-strand	797-802	6	17
β-strand	807-812	6	17
β-strand	817-822	6	17
β-strand	828-834	7	18
β-strand	839-844	6	18
β-strand	850-854	5	18
β-strand	862-865	4	18
β-strand	872	1	19
β-strand	876-878	3	19
β-strand	883-888	6	19
β-strand	893-897	5	19
β-strand	905-906	2	19
β-strand	916-922	7	20
β-strand	925-930	6	20
β-strand	935-940	6	20
β-strand	948-951	4	20
β-strand	957-964	8	15
α-helix	965-967	3
α-helix	980-983	4
β-strand	988-991	4	21
β-strand	995-998	4	21
β-strand	1004-1006	3	22
β-strand	1013-1015	3	22
α-helix	1021-1024	4
β-strand	1030-1032	3	23
β-strand	1038-1040	3	23
α-helix	1041-1043	3
α-helix	1082-1084	3
α-helix	1106-1108	3
β-strand	1113-1115	3	24
α-helix	1116	1
β-strand	1121-1123	3	24
α-helix	1124-1126	3
α-helix	1138-1140	3
β-strand	1153-1156	4	25
β-strand	1160-1163	4	25
α-helix	1164-1166	3
β-strand	1191-1193	3	26
β-strand	1200-1202	3	26
α-helix	1203-1205	3
β-strand	1234-1236	3	27
β-strand	1243-1245	3	27
α-helix	1246-1248	3
β-strand	1275-1277	3	28
β-strand	1283-1285	3	28
α-helix	1286-1288	3
α-helix	1352-1354	3
α-helix	1356-1359	4
β-strand	1363-1364	2	29
β-strand	1373-1374	2	29
β-strand	1379-1381	3	30
β-strand	1388-1390	3	30
β-strand	1403-1407	5	31
β-strand	1410-1414	5	31
β-strand	1419-1421	3	32
β-strand	1428-1430	3	32
β-strand	1436-1441	6	33
β-strand	1446-1451	6	33
β-strand	1458-1462	5	33
β-strand	1468-1474	7	34
β-strand	1479-1484	6	34
β-strand	1489-1494	6	34
β-strand	1501-1502	2	34
β-strand	1513-1517	5	35
β-strand	1522-1527	6	35
β-strand	1532-1537	6	35
β-strand	1544-1547	4	35
β-strand	1554-1560	7	36
β-strand	1567-1572	6	36
β-strand	1578-1583	6	36
β-strand	1590-1593	4	36
β-strand	1600-1606	7	37
β-strand	1611-1616	6	37
β-strand	1621-1626	6	37
β-strand	1633-1636	4	37
β-strand	1645-1651	7	38
β-strand	1654-1659	6	38
β-strand	1664-1669	6	38
β-strand	1677-1681	5	38
β-strand	1689-1692	4	33
β-strand	1713-1715	3	39
β-strand	1723-1725	3	39
β-strand	1731-1733	3	40
β-strand	1740-1742	3	40
β-strand	1747-1752	6	41
β-strand	1755-1760	6	41
β-strand	1774-1775	2	41
β-strand	1783-1786	4	42
β-strand	1791-1795	5	42
β-strand	1801-1805	5	42
β-strand	1812-1815	4	42
β-strand	1827-1829	3	43
β-strand	1834-1839	6	43
β-strand	1844-1849	6	43
β-strand	1857-1862	6	43
β-strand	1873-1879	7	44
β-strand	1884-1889	6	44
β-strand	1899-1904	6	44
β-strand	1911-1914	4	44
β-strand	1921-1927	7	45
β-strand	1932-1937	6	45
β-strand	1942-1947	6	45
β-strand	1953-1957	5	45
β-strand	1963-1969	7	46
β-strand	1972-1977	6	46
β-strand	1982-1986	5	46
β-strand	1995-1999	5	46
β-strand	2004-2010	7	41
α-helix	2021-2024	4
β-strand	2032-2035	4	47
β-strand	2041-2044	4	47
β-strand	2049-2051	3	48
β-strand	2058-2060	3	48
β-strand	2063-2069	7	49
β-strand	2072-2076	5	49
β-strand	2085	1	49
α-helix	2088-2089	2
β-strand	2090	1	49
β-strand	2099-2103	5	50
β-strand	2108-2112	5	50
β-strand	2124-2127	4	50
β-strand	2135-2138	4	50
β-strand	2146-2153	8	51
β-strand	2158-2164	7	51
β-strand	2169-2175	7	51
β-strand	2181-2187	7	51
β-strand	2192-2198	7	52
β-strand	2203-2208	6	52
β-strand	2214-2218	5	52
β-strand	2226-2229	4	52
β-strand	2236-2242	7	53
β-strand	2247-2252	6	53
β-strand	2257-2262	6	53
β-strand	2268-2273	6	53
β-strand	2280-2285	6	54
β-strand	2289-2294	6	54
β-strand	2299-2304	6	54
α-helix	2312-2313	2
β-strand	2314-2318	5	54
β-strand	2323-2330	8	49
α-helix	2331-2333	3
α-helix	2348-2352	5
β-strand	2356-2358	3	55
β-strand	2367-2369	3	55
β-strand	2374-2375	2	56
β-strand	2382-2383	2	56
β-strand	2389-2393	5	57
β-strand	2397-2402	6	57
α-helix	2413-2414	2
β-strand	2415-2416	2	57
β-strand	2421-2427	7	58
β-strand	2432-2438	7	58
β-strand	2444-2450	7	58
β-strand	2463	1	58
β-strand	2471-2473	3	59
β-strand	2480-2483	4	59
β-strand	2490-2493	4	59
β-strand	2501-2504	4	59
β-strand	2511	1	60
β-strand	2520	1	61
β-strand	2523-2524	2	62
β-strand	2525	1	60
β-strand	2532-2534	3	62
β-strand	2536	1	61
β-strand	2543-2546	4	62
β-strand	2557-2559	3	63
β-strand	2564-2569	6	63
β-strand	2574-2579	6	63
β-strand	2586-2589	4	63
β-strand	2595-2601	7	64
β-strand	2604-2609	6	64
β-strand	2614-2619	6	64
β-strand	2627-2628	2	64
β-strand	2639-2643	5	57
α-helix	2652-2654	3
α-helix	2659-2662	4
β-strand	2684-2687	4	65
α-helix	2688-2691	4
β-strand	2692-2695	4	65
α-helix	2701-2702	2
α-helix	2757-2759	3
α-helix	2769-2773	5
α-helix	3029-3033	5
β-strand	3036-3037	2	66
α-helix	3038	1
β-strand	3045-3046	2	66
α-helix	3047-3049	3
α-helix	3061-3063	3
α-helix	3065-3068	4
β-strand	3080-3081	2	67
β-strand	3087-3088	2	67
α-helix	3113-3115	3
β-strand	3126-3128	3	68
β-strand	3133-3135	3	68
β-strand	3141-3143	3	69
β-strand	3150-3152	3	69
α-helix	3155-3158	4
α-helix	3160-3162	3
β-strand	3169-3170	2	70
β-strand	3173-3174	2	70
β-strand	3182-3184	3	71
β-strand	3191-3193	3	71
α-helix	3197-3199	3
β-strand	3200-3204	5	72
β-strand	3209-3212	4	72
β-strand	3219-3223	5	72
β-strand	3229-3235	7	73
β-strand	3240-3245	6	73
β-strand	3250-3255	6	73
β-strand	3262-3265	4	73
β-strand	3272-3278	7	74
β-strand	3283-3288	6	74
β-strand	3293-3298	6	74
β-strand	3305-3308	4	74
β-strand	3311	1	75
β-strand	3319	1	75
β-strand	3323-3329	7	76
β-strand	3334-3339	6	76
β-strand	3345-3350	6	76
β-strand	3357-3360	4	76
β-strand	3367-3373	7	77
β-strand	3378-3383	6	77
β-strand	3388-3392	5	77
β-strand	3400-3404	5	77
β-strand	3410-3416	7	78
β-strand	3419-3424	6	78
β-strand	3429-3434	6	78
β-strand	3442-3446	5	78
α-helix	3450-3451	2
β-strand	3454-3457	4	72
α-helix	3459-3461	3
α-helix	3471-3475	5
β-strand	3479-3482	4	79
α-helix	3483	1
β-strand	3489-3492	4	79
β-strand	3497-3501	5	80
β-strand	3506-3510	5	80
β-strand	3516-3518	3	81
β-strand	3525-3527	3	81
α-helix	3528-3530	3
α-helix	3542-3544	3
α-helix	3548-3550	3
β-strand	3558-3559	2	82
β-strand	3565-3566	2	82
α-helix	3568-3570	3
α-helix	3582-3584	3
α-helix	3586-3589	4
β-strand	3598-3600	3	83
β-strand	3606-3608	3	83
α-helix	3609-3611	3
α-helix	3627-3632	6
α-helix	3635-3636	2
β-strand	3639-3641	3	84
β-strand	3647-3649	3	84
α-helix	3668-3672	5
α-helix	3674-3676	3
α-helix	3677-3679	3
β-strand	3683-3685	3	85
β-strand	3692-3694	3	85
α-helix	3695-3697	3
β-strand	3724-3726	3	86
β-strand	3732-3734	3	86
α-helix	3756-3759	4
β-strand	3763-3765	3	87
β-strand	3771-3773	3	87
α-helix	3774-3776	3
α-helix	3785-3787	3
β-strand	3802-3804	3	88
β-strand	3810-3812	3	88
α-helix	3813-3815	3
α-helix	3832-3834	3
β-strand	3847-3848	2	89
β-strand	3854-3855	2	89
β-strand	4021-4024	4	90
β-strand	4027-4030	4	90
β-strand	4036-4038	3	91
β-strand	4047-4049	3	91
α-helix	4053-4054	2
β-strand	4055-4059	5	92
β-strand	4064-4068	5	92
β-strand	4073-4078	6	92
β-strand	4084-4090	7	93
β-strand	4098-4105	8	93
β-strand	4114-4121	8	93
β-strand	4134-4135	2	93
β-strand	4144-4150	7	94
β-strand	4155-4160	6	94
β-strand	4165-4170	6	94
β-strand	4177-4180	4	94
β-strand	4187-4193	7	95
β-strand	4198-4203	6	95
β-strand	4209-4214	6	95
β-strand	4221-4224	4	95
β-strand	4231-4237	7	96
β-strand	4243-4248	6	96
β-strand	4253-4257	5	96
β-strand	4265-4269	5	96
β-strand	4274-4280	7	97
β-strand	4283-4288	6	97
β-strand	4293-4298	6	97
β-strand	4306-4310	5	97
β-strand	4319-4321	3	92
α-helix	4323-4325	3
α-helix	4330-4332	3
β-strand	4341-4345	5	98
β-strand	4348-4352	5	98
β-strand	4359	1	99
α-helix	4360	1
β-strand	4367	1	99
α-helix	4370-4371	2
α-helix	4377-4381	5
β-strand	4388-4391	4	100
β-strand	4397-4400	4	100

Chain B: 69 helices, 300 β-strands

Element	Residues	Length	Sheet
α-helix	43-45	3
α-helix	57-60	4
α-helix	212-214	3
β-strand	226-228	3	101
β-strand	234-236	3	101
α-helix	237-239	3
α-helix	258-259	2
β-strand	269-270	2	102
β-strand	279-280	2	102
α-helix	281-284	4
α-helix	309-312	4
β-strand	320-321	2	103
β-strand	328-329	2	103
β-strand	337-338	2	104
β-strand	345-346	2	104
α-helix	351-353	3
β-strand	362-365	4	105
β-strand	368-371	4	105
β-strand	377-380	4	106
β-strand	384-387	4	106
α-helix	392-394	3
β-strand	395-399	5	107
β-strand	404-408	5	107
β-strand	414-418	5	107
α-helix	419-421	3
β-strand	426-432	7	108
β-strand	437-442	6	108
β-strand	447-452	6	108
β-strand	459-462	4	108
β-strand	469-475	7	109
β-strand	480-485	6	109
β-strand	491-495	5	109
β-strand	502-505	4	109
β-strand	512-518	7	110
β-strand	523-528	6	110
β-strand	537-542	6	110
β-strand	549-552	4	110
β-strand	559-565	7	111
β-strand	570-575	6	111
β-strand	580-585	6	111
β-strand	592-596	5	111
β-strand	604-609	6	112
β-strand	613-618	6	112
β-strand	623-628	6	112
α-helix	635	1
β-strand	636-640	5	112
β-strand	648-651	4	107
α-helix	653-655	3
α-helix	667-669	3
β-strand	673-676	4	113
β-strand	687-690	4	113
β-strand	695-697	3	114
β-strand	704-706	3	114
β-strand	709-715	7	115
β-strand	719-722	4	115
α-helix	734-735	2
β-strand	736	1	115
β-strand	743-749	7	116
β-strand	754-759	6	116
β-strand	764-769	6	116
β-strand	776-779	4	116
β-strand	786-792	7	117
β-strand	797-802	6	117
β-strand	807-812	6	117
β-strand	817-823	7	117
β-strand	828-834	7	118
β-strand	839-844	6	118
β-strand	850-854	5	118
β-strand	862-865	4	118
β-strand	872-878	7	119
β-strand	883-888	6	119
β-strand	893-897	5	119
β-strand	905-906	2	119
β-strand	916-922	7	120
β-strand	925-930	6	120
β-strand	935-940	6	120
β-strand	948-952	5	120
β-strand	957-964	8	115
α-helix	980-983	4
β-strand	989-991	3	121
β-strand	995-997	3	121
β-strand	1004-1006	3	122
β-strand	1013-1015	3	122
β-strand	1030-1032	3	123
α-helix	1033	1
β-strand	1038-1040	3	123
α-helix	1067-1068	2
β-strand	1071-1072	2	124
β-strand	1080-1081	2	124
α-helix	1082-1084	3
α-helix	1101-1103	3
β-strand	1113-1116	4	125
β-strand	1120-1123	4	125
β-strand	1153	1	126
β-strand	1163	1	126
α-helix	1164-1166	3
α-helix	1178-1180	3
β-strand	1191-1193	3	127
β-strand	1200-1202	3	127
α-helix	1203-1205	3
β-strand	1234-1236	3	128
α-helix	1237	1
β-strand	1243-1245	3	128
α-helix	1246-1248	3
β-strand	1275-1276	2	129
β-strand	1284-1285	2	129
α-helix	1286-1288	3
α-helix	1352-1354	3
α-helix	1357-1359	3
β-strand	1363-1367	5	130
β-strand	1370-1374	5	130
β-strand	1379-1381	3	131
β-strand	1388-1390	3	131
β-strand	1404-1405	2	132
β-strand	1412-1413	2	132
β-strand	1419-1421	3	133
β-strand	1428-1430	3	133
α-helix	1434-1435	2
β-strand	1436-1441	6	134
β-strand	1446-1452	7	134
β-strand	1455-1462	8	134
β-strand	1468-1474	7	135
β-strand	1479-1484	6	135
β-strand	1489-1494	6	135
β-strand	1501-1502	2	135
β-strand	1511-1517	7	136
β-strand	1522-1527	6	136
β-strand	1532-1537	6	136
β-strand	1543-1547	5	136
β-strand	1554-1560	7	137
β-strand	1567-1572	6	137
β-strand	1578-1583	6	137
β-strand	1590-1593	4	137
β-strand	1600-1606	7	138
β-strand	1611-1616	6	138
β-strand	1621-1626	6	138
β-strand	1633-1636	4	138
β-strand	1645-1650	6	139
β-strand	1654-1659	6	139
β-strand	1664-1669	6	139
β-strand	1677-1681	5	139
β-strand	1689-1692	4	134
α-helix	1694-1696	3
β-strand	1712-1715	4	140
β-strand	1723-1726	4	140
β-strand	1731-1733	3	141
β-strand	1740-1742	3	141
β-strand	1747-1752	6	142
β-strand	1756-1760	5	142
β-strand	1774	1	142
β-strand	1783-1786	4	143
β-strand	1791-1795	5	143
β-strand	1801-1805	5	143
β-strand	1812-1815	4	143
β-strand	1827-1829	3	144
β-strand	1834-1839	6	144
β-strand	1844-1849	6	144
β-strand	1857-1861	5	144
β-strand	1873-1879	7	145
β-strand	1884-1889	6	145
β-strand	1899-1904	6	145
β-strand	1911-1915	5	145
β-strand	1921-1927	7	146
β-strand	1932-1937	6	146
β-strand	1942-1947	6	146
β-strand	1953-1957	5	146
β-strand	1963-1969	7	147
β-strand	1972-1977	6	147
β-strand	1982-1987	6	147
β-strand	1995-1999	5	147
β-strand	2004-2010	7	142
α-helix	2021-2024	4
β-strand	2035	1	148
β-strand	2041	1	148
β-strand	2049-2051	3	149
β-strand	2058-2060	3	149
β-strand	2064-2068	5	150
β-strand	2073-2076	4	150
β-strand	2090	1	150
β-strand	2099-2103	5	151
β-strand	2108-2112	5	151
α-helix	2119-2121	3
β-strand	2124-2127	4	151
β-strand	2135-2138	4	151
β-strand	2147-2153	7	152
β-strand	2158-2164	7	152
β-strand	2169-2175	7	152
β-strand	2181-2187	7	152
β-strand	2192-2198	7	153
β-strand	2203-2208	6	153
β-strand	2215-2218	4	153
β-strand	2226-2229	4	153
β-strand	2236-2242	7	154
β-strand	2247-2252	6	154
β-strand	2257-2262	6	154
β-strand	2268-2273	6	154
β-strand	2280-2286	7	155
β-strand	2289-2294	6	155
β-strand	2299-2303	5	155
α-helix	2312-2313	2
β-strand	2314-2318	5	155
β-strand	2325-2329	5	150
α-helix	2331-2333	3
α-helix	2338-2341	4
α-helix	2345-2347	3
α-helix	2349-2352	4
β-strand	2356-2358	3	156
β-strand	2367-2369	3	156
β-strand	2374-2375	2	157
β-strand	2382-2383	2	157
β-strand	2389-2393	5	158
β-strand	2397-2402	6	158
β-strand	2415-2416	2	158
β-strand	2421-2427	7	159
β-strand	2432-2438	7	159
β-strand	2444-2450	7	159
β-strand	2459-2465	7	159
β-strand	2471-2474	4	160
β-strand	2479-2484	6	160
β-strand	2489-2493	5	160
β-strand	2501-2504	4	160
β-strand	2509-2515	7	161
β-strand	2520-2526	7	161
β-strand	2530-2536	7	161
β-strand	2542-2547	6	161
β-strand	2553-2559	7	162
β-strand	2564-2569	6	162
β-strand	2574-2579	6	162
β-strand	2586-2590	5	162
β-strand	2595-2601	7	163
β-strand	2604-2609	6	163
β-strand	2614-2619	6	163
β-strand	2627-2628	2	163
β-strand	2639-2643	5	158
α-helix	2657-2660	4
β-strand	2683	1	164
β-strand	2686	1	165
β-strand	2691	1	165
β-strand	2694	1	164
α-helix	2729-2731	3
β-strand	2746-2747	2	166
β-strand	2753-2754	2	166
α-helix	2756-2758	3
α-helix	2770-2773	4
β-strand	3036-3038	3	167
β-strand	3044-3046	3	167
α-helix	3047-3049	3
α-helix	3065-3068	4
α-helix	3071-3073	3
β-strand	3080	1	168
β-strand	3088	1	168
α-helix	3104-3107	4
β-strand	3125-3128	4	169
β-strand	3133-3136	4	169
β-strand	3141-3143	3	170
β-strand	3150-3152	3	170
α-helix	3155-3158	4
α-helix	3160-3162	3
β-strand	3167-3170	4	171
β-strand	3173-3176	4	171
β-strand	3182-3183	2	172
β-strand	3192-3193	2	172
β-strand	3200-3204	5	173
β-strand	3209-3213	5	173
β-strand	3219-3223	5	173
β-strand	3229-3234	6	174
β-strand	3241-3245	5	174
β-strand	3250-3254	5	174
β-strand	3262-3265	4	174
β-strand	3272-3278	7	175
β-strand	3283-3288	6	175
β-strand	3293-3298	6	175
β-strand	3305-3308	4	175
β-strand	3311	1	176
β-strand	3319	1	176
β-strand	3323-3329	7	177
β-strand	3334-3339	6	177
β-strand	3345-3349	5	177
β-strand	3356-3359	4	177
β-strand	3367-3373	7	178
β-strand	3378-3383	6	178
β-strand	3388-3391	4	178
β-strand	3400-3403	4	178
β-strand	3410-3416	7	179
β-strand	3419-3424	6	179
β-strand	3429-3434	6	179
β-strand	3442-3446	5	179
β-strand	3452-3457	6	173
α-helix	3473-3475	3
β-strand	3479-3481	3	180
α-helix	3482-3483	2
β-strand	3490-3492	3	180
β-strand	3497-3500	4	181
β-strand	3507-3510	4	181
β-strand	3516-3518	3	182
β-strand	3525-3527	3	182
β-strand	3558-3559	2	183
β-strand	3565-3566	2	183
α-helix	3579-3581	3
α-helix	3586-3589	4
β-strand	3598-3601	4	184
β-strand	3604-3608	5	184
α-helix	3609-3611	3
α-helix	3628-3630	3
β-strand	3639-3640	2	185
β-strand	3648-3649	2	185
α-helix	3650-3652	3
β-strand	3660	1	186
β-strand	3662	1	186
α-helix	3668-3672	5
α-helix	3674-3676	3
β-strand	3683-3685	3	187
β-strand	3692-3694	3	187
α-helix	3695-3697	3
α-helix	3709-3711	3
β-strand	3724-3726	3	188
β-strand	3732-3734	3	188
α-helix	3735-3737	3
α-helix	3757-3759	3
β-strand	3763-3765	3	189
α-helix	3766	1
β-strand	3771-3773	3	189
α-helix	3774-3776	3
α-helix	3798-3799	2
β-strand	3802-3804	3	190
β-strand	3810-3812	3	190
β-strand	3847-3848	2	191
β-strand	3854-3855	2	191
α-helix	3857-3859	3
β-strand	4021-4022	2	192
β-strand	4029-4030	2	192
β-strand	4037-4038	2	193
β-strand	4047-4048	2	193
α-helix	4053-4054	2
β-strand	4055-4059	5	194
β-strand	4064-4068	5	194
β-strand	4073-4078	6	194
β-strand	4084-4090	7	195
β-strand	4098-4105	8	195
β-strand	4114-4121	8	195
β-strand	4133-4135	3	195
β-strand	4146-4150	5	196
β-strand	4155-4160	6	196
β-strand	4165-4170	6	196
β-strand	4176-4180	5	196
β-strand	4187-4193	7	197
β-strand	4198-4203	6	197
β-strand	4209-4214	6	197
β-strand	4221-4224	4	197
β-strand	4231-4237	7	198
β-strand	4243-4248	6	198
β-strand	4253-4257	5	198
β-strand	4265-4268	4	198
β-strand	4274-4279	6	199
β-strand	4283-4288	6	199
β-strand	4293-4298	6	199
β-strand	4306-4310	5	199
β-strand	4319-4321	3	194
α-helix	4323-4325	3
α-helix	4330-4332	3
β-strand	4341-4345	5	200
β-strand	4348-4352	5	200
β-strand	4359	1	201
α-helix	4360	1
β-strand	4367	1	201
α-helix	4370-4371	2
α-helix	4377-4379	3
β-strand	4388-4390	3	202
β-strand	4398-4400	3	202

Chain E: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3

Chain K: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	255-266	12
α-helix	273-308	36
α-helix	314-353	40

Chain L: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	253-266	14
α-helix	271-311	41
α-helix	314-352	39

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Alpha-2-macroglobulin receptor-associated protein	K, L	protein	344	Homo sapiens	P30533 (AlphaFold model)
Low-density lipoprotein receptor-related protein 2	A, B	protein	4473	Homo sapiens	P98164
Unidentified peptide 1	D, E	protein	10	Homo sapiens
Unidentified peptide 2	C, F, J	protein	7	Homo sapiens
Unidentified peptide 3	H	protein	12	Homo sapiens
Unidentified peptide 4	I	protein	8	Homo sapiens
Unidentified peptide 5	G	protein	13	Homo sapiens

Sequence of entity 1 (K, L), FASTA

>9QAW_1 Alpha-2-macroglobulin receptor-associated protein (chains K, L)
MSYSREKNQPKPSPKRESGEEFRMEKLNQLWEKAQRLHLPPVRLAELHADLKIQERDELA
WKKLKLDGLDEDGEKEARLIRNLNVILAKYGLDGKKDARQVTSNSLSGTQEDGLDDPRLE
KLWHKAKTSGKFSGEELDKLWREFLHHKEKVHEYNVLLETLSRTEEIHENVISPSDLSDI
KGSVLHSRHTELKEKLRSINQGLDRLRRVSHQGYSTEAEFEEPRVIDLWDLAQSANLTDK
ELEAFREELKHFEAKIEKHNHYQKQLEIAHEKLRHAESVGDGERVSRSREKHALLEGRTK
ELGYTVKKHLQDLSGRISRARHNELALEVLFQGPHHHHHHHHHH

Sequence of entity 2 (A, B), FASTA

>9QAW_2 Low-density lipoprotein receptor-related protein 2 (chains A, B)
MDRGPAAVACTLLLALVACLAPASGQECDSAHFRCGSGHCIPADWRCDGTKDCSDDADEI
GCAVVTCQQGYFKCQSEGQCIPNSWVCDQDQDCDDGSDERQDCSQSTCSSHQITCSNGQC
IPSEYRCDHVRDCPDGADENDCQYPTCEQLTCDNGACYNTSQKCDWKVDCRDSSDEINCT
EICLHNEFSCGNGECIPRAYVCDHDNDCQDGSDEHACNYPTCGGYQFTCPSGRCIYQNWV
CDGEDDCKDNGDEDGCESGPHDVHKCSPREWSCPESGRCISIYKVCDGILDCPGREDENN
TSTGKYCSMTLCSALNCQYQCHETPYGGACFCPPGYIINHNDSRTCVEFDDCQIWGICDQ
KCESRPGRHLCHCEEGYILERGQYCKANDSFGEASIIFSNGRDLLIGDIHGRSFRILVES
QNRGVAVGVAFHYHLQRVFWTDTVQNKVFSVDINGLNIQEVLNVSVETPENLAVDWVNNK
IYLVETKVNRIDMVNLDGSYRVTLITENLGHPRGIAVDPTVGYLFFSDWESLSGEPKLER
AFMDGSNRKDLVKTKLGWPAGVTLDMISKRVYWVDSRFDYIETVTYDGIQRKTVVHGGSL
IPHPFGVSLFEGQVFFTDWTKMAVLKANKFTETNPQVYYQASLRPYGVTVYHSLRQPYAT
NPCKDNNGGCEQVCVLSHRTDNDGLGFRCKCTFGFQLDTDERHCIAVQNFLIFSSQVAIR
GIPFTLSTQEDVMVPVSGNPSFFVGIDFDAQDSTIFFSDMSKHMIFKQKIDGTGREILAA
NRVENVESLAFDWISKNLYWTDSHYKSISVMRLADKTRRTVVQYLNNPRSVVVHPFAGYL
FFTDWFRPAKIMRAWSDGSHLLPVINTTLGWPNGLAIDWAASRLYWVDAYFDKIEHSTFD
GLDRRRLGHIEQMTHPFGLAIFGEHLFFTDWRLGAIIRVRKADGGEMTVIRSGIAYILHL
KSYDVNIQTGSNACNQPTHPNGDCSHFCFPVPNFQRVCGCPYGMRLASNHLTCEGDPTNE
PPTEQCGLFSFPCKNGRCVPNYYLCDGVDDCHDNSDEQLCGTLNNTCSSSAFTCGHGECI
PAHWRCDKRNDCVDGSDEHNCPTHAPASCLDTQYTCDNHQCISKNWVCDTDNDCGDGSDE
KNCNSTETCQPSQFNCPNHRCIDLSFVCDGDKDCVDGSDEVGCVLNCTASQFKCASGDKC
IGVTNRCDGVFDCSDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGS
DEHNACVPKTCPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQCL
GHNICVNLSVVCDGIFDCPNGTDESPLCNGNSCSDFNGGCTHECVQEPFGAKCLCPLGFL
LANDSKTCEDIDECDILGSCSQHCYNMRGSFRCSCDTGYMLESDGRTCKVTASESLLLLV
ASQNKIIADSVTSQVHNIYSLVENGSYIVAVDFDSISGRIFWSDATQGKTWSAFQNGTDR
RVVFDSSIILTETIAIDWVGRNLYWTDYALETIEVSKIDGSHRTVLISKNLTNPRGLALD
PRMNEHLLFWSDWGHHPRIERASMDGSMRTVIVQDKIFWPCGLTIDYPNRLLYFMDSYLD
YMDFCDYNGHHRRQVIASDLIIRHPYALTLFEDSVYWTDRATRRVMRANKWHGGNQSVVM
YNIQWPLGIVAVHPSKQPNSVNPCAFSRCSHLCLLSSQGPHFYSCVCPSGWSLSPDLLNC
LRDDQPFLITVRQHIIFGISLNPEVKSNDAMVPIAGIQNGLDVEFDDAEQYIYWVENPGE
IHRVKTDGTNRTVFASISMVGPSMNLALDWISRNLYSTNPRTQSIEVLTLHGDIRYRKTL
IANDGTALGVGFPIGITVDPARGKLYWSDQGTDSGVPAKIASANMDGTSVKTLFTGNLEH
LECVTLDIEEQKLYWAVTGRGVIERGNVDGTDRMILVHQLSHPWGIAVHDSFLYYTDEQY
EVIERVDKATGANKIVLRDNVPNLRGLQVYHRRNAAESSNGCSNNMNACQQICLPVPGGL
FSCACATGFKLNPDNRSCSPYNSFIVVSMLSAIRGFSLELSDHSETMVPVAGQGRNALHV
DVDVSSGFIYWCDFSSSVASDNAIRRIKPDGSSLMNIVTHGIGENGVRGIAVDWVAGNLY
FTNAFVSETLIEVLRINTTYRRVLLKVTVDMPRHIVVDPKNRYLFWADYGQRPKIERSFL
DCTNRTVLVSEGIVTPRGLAVDRSDGYVYWVDDSLDIIARIRINGENSEVIRYGSRYPTP
YGITVFENSIIWVDRNLKKIFQASKEPENTEPPTVIRDNINWLRDVTIFDKQVQPRSPAE
VNNNPCLENNGGCSHLCFALPGLHTPKCDCAFGTLQSDGKNCAISTENFLIFALSNSLRS
LHLDPENHSPPFQTINVERTVMSLDYDSVSDRIYFTQNLASGVGQISYATLSSGIHTPTV
IASGIGTADGIAFDWITRRIYYSDYLNQMINSMAEDGSNRTVIARVPKPRAIVLDPCQGY
LYWADWDTHAKIERATLGGNFRVPIVNSSLVMPSGLTLDYEEDLLYWVDASLQRIERSTL
TGVDREVIVNAAVHAFGLTLYGQYIYWTDLYTQRIYRANKYDGSGQIAMTTNLLSQPRGI
NTVVKNQKQQCNNPCEQFNGGCSHICAPGPNGAECQCPHEGNWYLANNRKHCIVDNGERC
GASSFTCSNGRCISEEWKCDNDNDCGDGSDEMESVCALHTCSPTAFTCANGRCVQYSYRC
DYYNDCGDGSDEAGCLFRDCNATTEFMCNNRRCIPREFICNGVDNCHDNNTSDEKNCPDR
TCQSGYTKCHNSNICIPRVYLCDGDNDCGDNSDENPTYCTTHTCSSSEFQCASGRCIPQH
WYCDQETDCFDASDEPASCGHSERTCLADEFKCDGGRCIPSEWICDGDNDCGDMSDEDKR
HQCQNQNCSDSEFLCVNDRPPDRRCIPQSWVCDGDVDCTDGYDENQNCTRRTCSENEFTC
GYGLCIPKIFRCDRHNDCGDYSDERGCLYQTCQQNQFTCQNGRCISKTFVCDEDNDCGDG
SDELMHLCHTPEPTCPPHEFKCDNGRCIEMMKLCNHLDDCLDNSDEKGCGINECHDPSIS
GCDHNCTDTLTSFYCSCRPGYKLMSDKRTCVDIDECTEMPFVCSQKCENVIGSYICKCAP
GYLREPDGKTCRQNSNIEPYLIFSNRYYLRNLTIDGYFYSLILEGLDNVVALDFDRVEKR
LYWIDTQRQVIERMFLNKTNKETIINHRLPAAESLAVDWVSRKLYWLDARLDGLFVSDLN
GGHRRMLAQHCVDANNTFCFDNPRGLALHPQYGYLYWADWGHRAYIGRVGMDGTNKSVII
STKLEWPNGITIDYTNDLLYWADAHLGYIEYSDLEGHHRHTVYDGALPHPFAITIFEDTI
YWTDWNTRTVEKGNKYDGSNRQTLVNTTHRPFDIHVYHPYRQPIVSNPCGTNNGGCSHLC
LIKPGGKGFTCECPDDFRTLQLSGSTYCMPMCSSTQFLCANNEKCIPIWWKCDGQKDCSD
GSDELALCPQRFCRLGQFQCSDGNCTSPQTLCNAHQNCPDGSDEDRLLCENHHCDSNEWQ
CANKRCIPESWQCDTFNDCEDNSDEDSSHCASRTCRPGQFRCANGRCIPQAWKCDVDNDC
GDHSDEPIEECMSSAHLCDNFTEFSCKTNYRCIPKWAVCNGVDDCRDNSDEQGCEERTCH
PVGDFRCKNHHCIPLRWQCDGQNDCGDNSDEENCAPRECTESEFRCVNQQCIPSRWICDH
YNDCGDNSDERDCEMRTCHPEYFQCTSGHCVHSELKCDGSADCLDASDEADCPTRFPDGA
YCQATMFECKNHVCIPPYWKCDGDDDCGDGSDEELHLCLDVPCNSPNRFRCDNNRCIYSH
EVCNGVDDCGDGTDETEEHCRKPTPKPCTEYEYKCGNGHCIPHDNVCDDADDCGDWSDEL
GCNKGKERTCAENICEQNCTQLNEGGFICSCTAGFETNVFDRTSCLDINECEQFGTCPQH
CRNTKGSYECVCADGFTSMSDRPGKRCAAEGSSPLLLLPDNVRIRKYNLSSERFSEYLQD
EEYIQAVDYDWDPKDIGLSVVYYTVRGEGSRFGAIKRAYIPNFESGRNNLVQEVDLKLKY
VMQPDGIAVDWVGRHIYWSDVKNKRIEVAKLDGRYRKWLISTDLDQPAAIAVNPKLGLMF
WTDWGKEPKIESAWMNGEDRNILVFEDLGWPTGLSIDYLNNDRIYWSDFKEDVIETIKYD
GTDRRVIAKEAMNPYSLDIFEDQLYWISKEKGEVWKQNKFGQGKKEKTLVVNPWLTQVRI
FHQLRYNKSVPNLCKQICSHLCLLRPGGYSCACPQGSSFIEGSTTECDAAIELPINLPPP
CRCMHGGNCYFDETDLPKCKCPSGYTGKYCEMAFSKGISPGTTGWSHPQFEKAGGGSGGG
SGGGSWSHPQFEKGGGSGGGSGGGSWSHPQFEK

Sequence of entity 3 (D, E), FASTA

>9QAW_3 Unidentified peptide 1 (chains D, E)
XXXXXXXXXX

Sequence of entity 4 (C, F, J), FASTA

>9QAW_4 Unidentified peptide 2 (chains C, F, J)
XXXXXXX

Sequence of entity 5 (H), FASTA

>9QAW_5 Unidentified peptide 3 (chains H)
XXXXXXXXXXXX

Sequence of entity 6 (I), FASTA

>9QAW_6 Unidentified peptide 4 (chains I)
XXXXXXXX

Sequence of entity 7 (G), FASTA

>9QAW_7 Unidentified peptide 5 (chains G)
XXXXXXXXXXXXX

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	19
BMA	beta-D-mannopyranose	C6 H12 O6	2
NGA	2-acetamido-2-deoxy-beta-D-galactopyranose	C8 H15 N O6	7
CA	Calcium ion	Ca	25
NI	Nickel (II) ion	Ni	2

Primary citation

CryoEM structure of the human LRP2 receptor ectodomain in complex with LRPAP1. Ramanadane, K., Coscia, F. To be published.

Other PDB entries of the same protein (UniProt P30533 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2FCW 1.26 Å, Structure of a Complex Between the Pair of the LDL Receptor Ligand-Binding Modules 3-4…
1LRE Receptor associated protein (RAP) domain 1, NMR, 20 structures
1NRE Receptor associated protein (RAP) domain 1, NMR, minimized average structure
1OP1 Solution NMR structure of domain 1 of receptor associated protein
1OV2 Ensemble of the solution structures of domain one of receptor associated protein
2FTU solution structure of domain 3 of RAP
2FYL Haddock model of the complex between double module of LRP, CR56, and first domain of…
2P01 The structure of receptor-associated protein(RAP)
2P03 The structure of receptor-associated protein(RAP)

Browse structure collections

About this viewer

MolViewer shows 9QAW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.