AP2-associated protein kinase 1 (AAK1) bound to CKJB68. Determined by X-ray diffraction at 2.0 Å resolution. Released 9 Apr 2025.
Explore 9QB5 in 3D Show helices and sheets RCSB PDB PDBe
9QB5 contains 29 α-helices and 32 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 38-41 | 4 | 1 |
| β-strand | 44-55 | 12 | 1 |
| β-strand | 58-65 | 8 | 1 |
| β-strand | 70-78 | 9 | 1 |
| α-helix | 81-97 | 17 | |
| β-strand | 103 | 1 | 2 |
| α-helix | 104-105 | 2 | |
| β-strand | 106-115 | 10 | 1 |
| β-strand | 119-127 | 9 | 1 |
| β-strand | 132-133 | 2 | 2 |
| α-helix | 134-139 | 6 | |
| α-helix | 148-166 | 19 | |
| β-strand | 173 | 1 | 3 |
| α-helix | 179-181 | 3 | |
| β-strand | 182-184 | 3 | 2 |
| β-strand | 190-192 | 3 | 2 |
| β-strand | 199 | 1 | 3 |
| β-strand | 203 | 1 | 4 |
| α-helix | 205-208 | 4 | |
| α-helix | 210-220 | 11 | |
| α-helix | 223-225 | 3 | |
| α-helix | 228-231 | 4 | |
| β-strand | 239 | 1 | 4 |
| α-helix | 242-257 | 16 | |
| α-helix | 266-271 | 6 | |
| β-strand | 276 | 1 | 5 |
| α-helix | 284-293 | 10 | |
| α-helix | 304-315 | 12 | |
| α-helix | 333-337 | 5 | |
| β-strand | 338 | 1 | 5 |
| α-helix | 339-341 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 38-41 | 4 | 6 |
| β-strand | 44-55 | 12 | 6 |
| β-strand | 58-65 | 8 | 6 |
| β-strand | 70-78 | 9 | 6 |
| α-helix | 81-97 | 17 | |
| β-strand | 103 | 1 | 7 |
| α-helix | 104-105 | 2 | |
| β-strand | 106-115 | 10 | 6 |
| β-strand | 119-127 | 9 | 6 |
| β-strand | 132-133 | 2 | 7 |
| α-helix | 134-139 | 6 | |
| α-helix | 148-166 | 19 | |
| β-strand | 173 | 1 | 8 |
| α-helix | 179-181 | 3 | |
| β-strand | 182-184 | 3 | 7 |
| β-strand | 190-192 | 3 | 7 |
| β-strand | 199 | 1 | 8 |
| β-strand | 203 | 1 | 9 |
| α-helix | 205-208 | 4 | |
| α-helix | 210-220 | 11 | |
| α-helix | 223-225 | 3 | |
| α-helix | 228-231 | 4 | |
| β-strand | 239 | 1 | 9 |
| α-helix | 242-257 | 16 | |
| α-helix | 266-271 | 6 | |
| β-strand | 275-276 | 2 | 10 |
| α-helix | 284-293 | 10 | |
| α-helix | 304-315 | 12 | |
| α-helix | 327-330 | 4 | |
| β-strand | 337-338 | 2 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| AP2-associated protein kinase 1 | A, B | protein | 318 | Homo sapiens | Q2M2I8 (AlphaFold model) |
>9QB5_1 AP2-associated protein kinase 1 (chains A, B) MGLGSGYIGRVFGIGRQQVTVDEVLAEGGFAIVFLVRTSNGMKCALKRMFVNNEHDLQVC KREIQIMRDLSGHKNIVGYIDSSINNVSSGDVWEVLILMDFCRGGQVVNLMNQRLQTGFT ENEVLQIFCDTCEAVARLHQCKTPIIHRDLKVENILLHDRGHYVLCDFGSATNKFQNPQT EGVNAVEDEIKKYTTLSYRAPEMVNLYSGKIITTKADIWALGCLLYKLCYFTLPFGESQV AICDGNFTIPDNSRYSQDMHCLIRYMLEPDPDKRPDIYQVSYFSFKLLKKECPIPNVQNS PIPAKLPEPVKASEAAAK
| ID | Name | Formula | Copies |
|---|---|---|---|
| F7I | ~{N}-(phenylmethyl)-7,10-dioxa-13,17,18,21-tetrazatetracyclo[12.5.2.1^{2,6}.0^{… | C24 H23 N5 O3 | 2 |
Water and common crystallization additives (SO4) are not listed.
Development of pyrazolo[1,5-a]pyrimidine based macrocyclic kinase inhibitors targeting AAK1. Mensing, T.E., Kurz, C.G., Amrhein, J.A. et al. Eur J Med Chem (2025) 299:118076-118076. DOI 10.1016/j.ejmech.2025.118076 · PubMed
Other PDB entries of the same protein (UniProt Q2M2I8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9QB5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.