9QJZ: ARC4 from human Tankyrase 2

Crystal structure of ARC4 from human Tankyrase 2 in complex with phosphorylated peptide from human MDC1. Determined by X-ray diffraction at 2.31 Å resolution. Released 5 Nov 2025.

Method: X-ray diffraction
Resolution: 2.31 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,587
Mol. weight: 39.73 kDa
Released: 5 Nov 2025

Explore 9QJZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9QJZ contains 23 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	491-502	12
α-helix	505-511	7
α-helix	529-535	7
α-helix	539-547	9
α-helix	562-568	7
α-helix	572-580	9
α-helix	595-602	8
α-helix	605-613	9
α-helix	629-631	3
α-helix	632-633	2
α-helix	637-644	8
α-helix	646-648	3

Chain B: 11 helices, 0 β-strands

Element	Residues	Length
α-helix	491-502	12
α-helix	505-511	7
α-helix	529-535	7
α-helix	539-547	9
α-helix	562-568	7
α-helix	572-580	9
α-helix	595-602	8
α-helix	605-613	9
α-helix	628-631	4
α-helix	632-633	2
α-helix	637-642	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Poly [ADP-ribose] polymerase tankyrase-2	A, B	protein	167	Homo sapiens	Q9H2K2 (AlphaFold model)
Mediator of DNA damage checkpoint protein 1	C, D	protein	16	Homo sapiens	Q14676 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9QJZ_1 Poly [ADP-ribose] polymerase tankyrase-2 (chains A, B)
GAMGSGNSEADRQLLEAAKAGDVETVKKLCTVQSVNCRDIEGRQSTPLHFAAGYNRVSVV
EYLLQHGADVHAKDKGGLVPLHNACSYGHYEVAELLVKHGAVVNVADLWKFTPLHEAAAK
GKYEICKLLLQHGADPTKKNRDGNTPLDLVKDGDTDIQDLLRGDAAL

Sequence of entity 2 (C, D), FASTA

>9QJZ_2 Mediator of DNA damage checkpoint protein 1 (chains C, D)
ERDTQRGEPEGGSQDQ

Primary citation

Phosphorylation as a candidate regulatory mechanism for effector recruitment to tankyrase. Broadway, B.J., Pollock, K., Cronin, N. et al. R Soc Open Sci (2025) 12:250824-250824. DOI 10.1098/rsos.250824 · PubMed

Other PDB entries of the same protein (UniProt Q9H2K2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5BXO 1.33 Å, Human Tankyrase-2 in Complex with Macrocyclised Extended Peptide cp4n2m3
5BXU 1.35 Å, Human Tankyrase-2 in Complex with Macrocyclised Extended Peptide cp4n4m5
5NWG 1.4 Å, Crystal structure of TNKS2 in complex with 7-chloro-2-{4-[(2-hydroxyethyl)(methyl)amino]p…
5NWD 1.45 Å, Crystal structure of TNKS2 in complex with 2-[4-(diethylamino)phenyl]-3,4-dihydroquinazol…
4PNL 1.5 Å, Crystal structure of TNKS-2 in complex with DR2313.
5NVE 1.5 Å, Crystal structure of TNKS2 in complex with 2-(4-ethoxyphenyl)-3,4-dihydroquinazolin-4-one
5NWC 1.5 Å, Crystal structure of TNKS2 in complex with 2-(2-aminophenyl)-3,4-dihydroquinazolin-4-one
7CE4 1.5 Å, Tankyrase2 catalytic domain in complex with K-476
5JRT 1.53 Å, Crystal structure of the human Tankyrase 2 (TNKS2) SAM domain (DH902/924RE)
3TWR 1.55 Å, Crystal structure of ARC4 from human Tankyrase 2 in complex with peptide from human 3BP2
5C5R 1.55 Å, Crystal structure of human tankyrase-2 in complex with a pyranopyridone inhibitor
5NVF 1.55 Å, Crystal structure of TNKS2 in complex with 2-[4-(pyridin-2-yl)phenyl]-3,4-dihydroquinazol…

Browse structure collections

About this viewer

MolViewer shows 9QJZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.