Solution NMR structure of SNX9 SH3 in complex with EspF. Determined by solution NMR. Released 22 Oct 2025.
Explore 9R4W in 3D Show helices and sheets RCSB PDB PDBe
9R4W contains 5 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1-3 | 3 | |
| β-strand | 4-7 | 4 | 1 |
| β-strand | 19 | 1 | 1 |
| β-strand | 27-32 | 6 | 1 |
| β-strand | 39-43 | 5 | 1 |
| β-strand | 49-53 | 5 | 1 |
| β-strand | 57-59 | 3 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 123-127 | 5 | |
| α-helix | 130-132 | 3 | |
| α-helix | 137-144 | 8 | |
| α-helix | 152-155 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| LEE-encoded effector EspF | B | protein | 48 | Escherichia coli | A0A376PNR8 (AlphaFold model) |
| Sorting nexin-9 | A | protein | 67 | Homo sapiens | Q9Y5X1 (AlphaFold model) |
>9R4W_1 LEE-encoded effector EspF (chains B) GTVNFKPTRPAPPPPTSGQASGASRPLPPIAQALKDHLAAYELSKASE
>9R4W_2 Sorting nexin-9 (chains A) GSHMATKARVMYDFAAEPGNNELTVNEGEIITITNPDVGGGWLEGRNIKGERGLVPTDYV EILPSDG
Intrinsically disordered enteropathogenic E. coli EspF exploits motif mimicry in high-affinity binding to neural Wiskott-Aldrich syndrome protein and sorting nexin 9. Tossavainen, H., Karjalainen, M., Antenucci, L. et al. Int J Biol Macromol (2025) 330:148227-148227. DOI 10.1016/j.ijbiomac.2025.148227 · PubMed
Other PDB entries of the same protein (UniProt A0A376PNR8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9R4W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.