9R4V: N-WASP GBD

Solution structure of N-WASP GBD in complex with EspF. Determined by solution NMR. Released 22 Oct 2025.

Method: Solution NMR
Organisms: Homo sapiens, Escherichia coli
Chains: 2
Atoms: 930
Mol. weight: 13.22 kDa
Released: 22 Oct 2025

Explore 9R4V in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9R4V contains 9 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	204-206	3
α-helix	207-211	5
β-strand	217-218	2	1
β-strand	222-223	2	1
α-helix	230-239	10
α-helix	243-246	4
α-helix	249-262	14
α-helix	265-272	8

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	125-127	3
α-helix	138-141	4
α-helix	142-158	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Actin nucleation-promoting factor WASL	A	protein	73	Homo sapiens	O00401 (AlphaFold model)
LEE-encoded effector EspF	B	protein	48	Escherichia coli	A0A376PNR8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9R4V_1 Actin nucleation-promoting factor WASL (chains A)
GSHMSNFQHIGHVGWDPNTGFDLNNLDPELKNLFDMCGISEAQLKDRETSKVIYDFIEKT
GGVEAVKNELRRQ

Sequence of entity 2 (B), FASTA

>9R4V_2 LEE-encoded effector EspF (chains B)
GTVNFKPSRPAPPPPTSGQASGASRPLPPIAQALKDHLAAYELSKASE

Primary citation

Intrinsically disordered enteropathogenic E. coli EspF exploits motif mimicry in high-affinity binding to neural Wiskott-Aldrich syndrome protein and sorting nexin 9. Tossavainen, H., Karjalainen, M., Antenucci, L. et al. Int J Biol Macromol (2025) 330:148227-148227. DOI 10.1016/j.ijbiomac.2025.148227 · PubMed

Other PDB entries of the same protein (UniProt O00401 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4CC2 1.55 Å, Complex of human Tuba C-terminal SH3 domain with human N-WASP proline- rich peptide -…
4CC7 1.97 Å, Crystal structure of the sixth or C-terminal SH3 domain of human Tuba in complex with…
2FF3 2.0 Å, Crystal structure of Gelsolin domain 1:N-wasp V2 motif hybrid in complex with actin
9DLX 2.91 Å, Bovine Arp2/3 complex with N-WASP CA bound to Arp3 and Arp2-ArpC1
2VCP 3.2 Å, Crystal structure of N-Wasp VC domain in complex with skeletal actin
2LNH Enterohaemorrhagic E. coli (EHEC) exploits a tryptophan switch to hijack host F-actin…
9R3Y Solution NMR structure of N-WASP GBD in complex with EspFu R5

Browse structure collections

About this viewer

MolViewer shows 9R4V directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.