9RJG: Mycobacterium tuberculosis InhA

Structure of Mycobacterium tuberculosis InhA in complex with pyridomycin (compound 1). Determined by X-ray diffraction at 1.71 Å resolution. Released 11 Feb 2026.

Method: X-ray diffraction
Resolution: 1.71 Å
Organism: Mycobacterium tuberculosis
Chains: 6
Atoms: 13,037
Mol. weight: 176.42 kDa
Ligands: PYW
Released: 11 Feb 2026

Explore 9RJG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9RJG contains 82 α-helices and 50 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	9-12	4	1
α-helix	21-31	11
β-strand	35-40	6	1
α-helix	44-51	8
β-strand	60-62	3	1
α-helix	68-82	15
β-strand	88-93	6	1
α-helix	100-102	3
α-helix	108-110	3
α-helix	113-120	8
α-helix	121-125	5
α-helix	126-134	9
α-helix	135-137	3
β-strand	138-148	11	1
α-helix	159-180	22
β-strand	185-191	7	1
α-helix	199-203	5
α-helix	208-225	18
α-helix	236-246	11
β-strand	256-260	5	1
α-helix	264-266	3

Chain B: 14 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	9-12	4	2
α-helix	21-31	11
β-strand	35-40	6	2
α-helix	48-51	4
β-strand	60-62	3	2
α-helix	68-82	15
β-strand	88-93	6	2
α-helix	100-102	3
α-helix	108-110	3
α-helix	113-120	8
α-helix	121-125	5
α-helix	126-134	9
α-helix	135-137	3
β-strand	138-148	11	2
α-helix	159-180	22
β-strand	185-191	7	2
α-helix	197-203	7
α-helix	208-225	18
α-helix	236-246	11
β-strand	256-260	5	2
α-helix	264-266	3

Chain C: 14 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	9-12	4	3
α-helix	21-31	11
α-helix	34	1
β-strand	35-40	6	3
α-helix	44-51	8
β-strand	60-62	3	3
α-helix	68-82	15
β-strand	88-93	6	3
α-helix	100-102	3
α-helix	108-110	3
α-helix	113-120	8
α-helix	121-125	5
α-helix	126-134	9
α-helix	135-137	3
β-strand	138-148	11	3
β-strand	154	1	4
α-helix	159-180	22
β-strand	185-191	7	3
α-helix	210-225	16
α-helix	236-246	11
β-strand	256-260	5	3
α-helix	264-266	3
β-strand	267	1	5

Chains D and E: 13 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	9-12	4	6
α-helix	21-31	11
β-strand	35-40	6	6
α-helix	44-51	8
β-strand	60-62	3	6
α-helix	68-82	15
β-strand	88-93	6	6
α-helix	100-102	3
α-helix	108-110	3
α-helix	113-120	8
α-helix	121-125	5
α-helix	126-134	9
α-helix	135-137	3
β-strand	138-148	11	6
β-strand	154	1	7
α-helix	159-180	22
β-strand	185-191	7	6
α-helix	208-225	18
α-helix	236-246	11
β-strand	256-260	5	6
α-helix	264-266	3
β-strand	267	1	8

Chain F: 14 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	9-12	4	10
α-helix	21-31	11
β-strand	35-40	6	10
α-helix	44-51	8
β-strand	60-62	3	10
α-helix	68-82	15
β-strand	88-93	6	10
α-helix	100-102	3
α-helix	108-110	3
α-helix	113-120	8
α-helix	121-125	5
α-helix	126-134	9
α-helix	135-137	3
β-strand	138-148	11	10
β-strand	154	1	8
α-helix	159-180	22
β-strand	185-191	7	10
α-helix	197-201	5
α-helix	214-225	12
α-helix	236-246	11
β-strand	256-260	5	10
α-helix	264-266	3
β-strand	267	1	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Enoyl-[acyl-carrier-protein] reductase [NADH]	A, B, C, D, E, F	protein	272	Mycobacterium tuberculosis	P9WGR1 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>9RJG_1 Enoyl-[acyl-carrier-protein] reductase [NADH] (chains A, B, C, D, E, F)
GSHMTGLLDGKRILVSGIITDSSIAFHIARVAQEQGAQLVLTGFDRLRLIQRITDRLPAK
APLLELDVQNEEHLASLAGRVTEAIGAGNKLDGVVHSIGFMPQTGMGINPFFDAPYADVS
KGIHISAYSYASMAKALLPIMNPGGSIVGMDFDPSRAMPAYNWMTVAKSALESVNRFVAR
EAGKYGVRSNLVAAGPIRTLAMSAIVGGALGEEAGAQIQLLEEGWDQRAPIGWNMKDATP
VAKTVCALLSDWLPATTGDIIYADGGAHTQLL

Ligands and cofactors

ID	Name	Formula	Copies
PYW	Pyridomycin	C27 H32 N4 O8	6

Water and common crystallization additives (PGE) are not listed.

Primary citation

Optimizing the Antibiotic Potency and Metabolic Stability of Pyridomycin Using a Semisynthetic Approach. Valderrama, K., Horlacher, O., Publicola, G. et al. J Med Chem (2026) 69:2496-2508. DOI 10.1021/acs.jmedchem.5c02409 · PubMed

Other PDB entries of the same protein (UniProt P9WGR1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4TRO 1.4 Å, Structure of the enoyl-ACP reductase of Mycobacterium tuberculosis InhA, inhibited with…
28IQ 1.51 Å, structure of InhA from Mycobacterium tuberculosis in complex with…
28IT 1.51 Å, structure of InhA from Mycobacterium tuberculosis in complex with…
5G0T 1.54 Å, InhA in complex with a DNA encoded library hit
28IP 1.59 Å, structure of InhA from Mycobacterium tuberculosis in complex with…
4OHU 1.6 Å, Crystal structure of Mycobacterium tuberculosis InhA in complex with inhibitor PT92
8OTM 1.6 Å, structure of InhA from mycobacterium tuberculosis in complex with…
4TZK 1.62 Å, Crystal structure of Mycobacterium tuberculosis enoyl reductase (INHA) complexed WITH…
4U0J 1.62 Å, Crystal structure of Mycobacterium tuberculosis enoyl reductase (INHA) complexed with…
4D0S 1.64 Å, Mtb InhA complex with Pyradizinone compound 14
9RJK 1.66 Å, Structure of Mycobacterium tuberculosis InhA in complex with pyridomycin derivative…
28IR 1.69 Å, structure of InhA from Mycobacterium tuberculosis in complex with…

Browse structure collections

About this viewer

MolViewer shows 9RJG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.