9RLC: LolCDE complex with Lpp lipoprotein

Name: PDB 9RLC: LolCDE complex with Lpp lipoprotein
Published: 2026-01-21
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: protein transport

LolCDE complex with Lpp lipoprotein. Determined by electron microscopy at 2.8 Å resolution. Released 21 Jan 2026.

Method: Electron microscopy
Resolution: 2.8 Å
Organism: Escherichia coli K-12
Chains: 5
Atoms: 9,870
Mol. weight: 149.81 kDa
Ligands: PLM, Z41
Released: 21 Jan 2026

Explore 9RLC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9RLC contains 50 α-helices and 55 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 18 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	5-14	10
α-helix	21-27	7
α-helix	29-55	27
α-helix	56-60	5
β-strand	66-69	4	1
β-strand	75	1	2
α-helix	82-84	3
β-strand	90-96	7	1
β-strand	98-104	7	3
β-strand	109-117	9	3
α-helix	126-128	3
β-strand	129-130	2	3
α-helix	134-136	3
β-strand	143-147	5	3
α-helix	148-154	7
β-strand	160-161	2	3
β-strand	163-165	3	3
β-strand	181	1	3
α-helix	184	1
β-strand	185-190	6	3
α-helix	195-198	4
β-strand	200-204	5	3
α-helix	205-211	7
α-helix	214-215	2
β-strand	219	1	2
β-strand	221-226	6	1
α-helix	235-237	3
α-helix	240-241	2
β-strand	245-248	4	1
α-helix	250-303	54
α-helix	307-347	41
α-helix	362-389	28
α-helix	392-395	4

Chain D: 7 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	4-9	6	7
β-strand	13-15	3	8
β-strand	22-25	4	8
β-strand	31-33	3	7
β-strand	37-41	5	9
α-helix	50-55	6
β-strand	65-68	4	7
β-strand	72	1	7
α-helix	78-88	11
β-strand	90-93	4	9
α-helix	104-114	11
α-helix	119-133	15
α-helix	150-160	11
β-strand	166-170	5	9
α-helix	178-194	17
β-strand	198-203	6	9
α-helix	208-211	4
β-strand	214-218	5	9
β-strand	223-224	2	9

Chain E: 16 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	5-16	12
α-helix	22-58	37
β-strand	66-69	4	4
β-strand	70	1	5
α-helix	78-86	9
β-strand	91-99	9	4
β-strand	102-103	2	6
β-strand	112-113	2	6
β-strand	114-118	5	4
α-helix	120-126	7
α-helix	129-132	4
β-strand	133	1	4
β-strand	147-151	5	4
α-helix	152-158	7
β-strand	166-170	5	6
β-strand	183-187	5	6
β-strand	188-193	6	4
α-helix	198-202	5
β-strand	203-207	5	4
α-helix	208-214	7
β-strand	223-228	6	4
α-helix	231-233	3
α-helix	234-244	11
β-strand	249-251	3	5
β-strand	252-253	2	4
α-helix	255-297	43
α-helix	299-308	10
α-helix	312-343	32
α-helix	345-356	12
α-helix	377-403	27
α-helix	407-411	5

Chain F: 8 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	6-9	4	10
β-strand	13-15	3	11
β-strand	22-25	4	11
β-strand	31-32	2	10
β-strand	37-41	5	12
α-helix	50-55	6
β-strand	65-68	4	10
β-strand	72	1	10
α-helix	73-75	3
α-helix	78-88	11
β-strand	90-92	3	12
α-helix	104-115	12
α-helix	119-133	15
α-helix	150-159	10
β-strand	166-170	5	12
α-helix	178-195	18
β-strand	198-202	5	12
α-helix	208-210	3
β-strand	214-218	5	12
β-strand	223-224	2	12

Chain L: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	9-11	3
β-strand	13-15	3	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Lipoprotein-releasing system transmembrane protein LolC	C	protein	399	Escherichia coli K-12	P0ADC3 (AlphaFold model)
Lipoprotein-releasing system transmembrane protein LolE	E	protein	414	Escherichia coli K-12	P75958 (AlphaFold model)
Lipoprotein-releasing system ATP-binding protein LolD	D, F	protein	240	Escherichia coli K-12	P75957 (AlphaFold model)
Major outer membrane lipoprotein Lpp	L	protein	69	Escherichia coli K-12	P69776 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>9RLC_1 Lipoprotein-releasing system transmembrane protein LolC (chains C)
MYQPVALFIGLRYMRGRAADRFGRFVSWLSTIGITLGVMALVTVLSVMNGFERELQNNIL
GLMPQAILSSEHGSLNPQQLPETAVKLDGVNRVAPITTGDVVLQSARSVAVGVMLGIDPA
QKDPLTPYLVNVKQTDLEPGKYNVILGEQLASQLGVNRGDQIRVMVPSASQFTPMGRIPS
QRLFNVIGTFAANSEVDGYEMLVNIEDASRLMRYPAGNITGWRLWLDEPLKVDSLSQQKL
PEGSKWQDWRDRKGELFQAVRMEKNMMGLLLSLIVAVAAFNIITSLGLMVMEKQGEVAIL
QTQGLTPRQIMMVFMVQGASAGIIGAILGAALGALLASQLNNLMPIIGVLLDGAALPVAI
EPLQVIVIALVAMAIALLSTLYPSWRAAATQPAEALRYE

Sequence of entity 2 (E), FASTA

>9RLC_2 Lipoprotein-releasing system transmembrane protein LolE (chains E)
MAMPLSLLIGLRFSRGRRRGGMVSLISVISTIGIALGVAVLIVGLSAMNGFERELNNRIL
AVVPHGEIEAVDQPWTNWQEALDHVQKVPGIAAAAPYINFTGLVESGANLRAIQVKGVNP
QQEQRLSALPSFVQGDAWRNFKAGEQQIIIGKGVADALKVKQGDWVSIMIPNSNPEHKLM
QPKRVRLHVAGILQLSGQLDHSFAMIPLADAQQYLDMGSSVSGIALKMTDVFNANKLVRD
AGEVTNSYVYIKSWIGTYGYMYRDIQMIRAIMYLAMVLVIGVACFNIVSTLVMAVKDKSG
DIAVLRTLGAKDGLIRAIFVWYGLLAGLFGSLCGVIIGVVVSLQLTPIIEWIEKLIGHQF
LSSDIYFIDFLPSELHWLDVFYVLVTALLLSLLASWYPARRASNIDPARVLSGQ

Sequence of entity 3 (D, F), FASTA

>9RLC_3 Lipoprotein-releasing system ATP-binding protein LolD (chains D, F)
MNKILLQCDNLCKRYQEGSVQTDVLHNVSFSVGEGEMMAIVGSSGSGKSTLLHLLGGLDT
PTSGDVIFNGQPMSKLSSAAKAELRNQKLGFIYQFHHLLPDFTALENVAMPLLIGKKKPA
EINSRALEMLKAVGLDHRANHRPSELSGGERQRVAIARALVNNPRLVLADEPTGNLDARN
ADSIFQLLGELNRLQGTAFLVVTHDLQLAKRMSRQLEMRDGRLTAELSLMGAEGSHHHHH

Sequence of entity 4 (L), FASTA

>9RLC_4 Major outer membrane lipoprotein Lpp (chains L)
CSSNAKIDQPSSDVQTLNAKVDQLSNDVNAMRSDVQAAKDDAARANQRLDNMATKYRLES
AWSHPQFEK

Ligands and cofactors

ID	Name	Formula	Copies
PLM	Palmitic acid	C16 H32 O2	1
Z41	(2S)-3-hydroxypropane-1,2-diyl dihexadecanoate	C35 H68 O5	1

Primary citation

Liganded LolCDE structures reveal a common substrate-LolE interaction guiding bacterial lipoprotein transport. Szewczyk, P., Greene, N.P., Symmons, M.F. et al. Proc Natl Acad Sci U S A (2026) 123:e2520579123-e2520579123. DOI 10.1073/pnas.2520579123 · PubMed

Other PDB entries of the same protein (UniProt P0ADC3 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5NAA 1.88 Å, Lipoprotein-releasing system transmembrane protein LolC
6F3Z 2.0 Å, Complex of E. coli LolA and periplasmic domain of LolC
6F49 2.02 Å, Periplasmic domain of LolC lacking the Hook.
9XRO 2.88 Å, LolCDE in complex with SMT-738_3
9RLJ 2.9 Å, LolCDE with bound ATPgammaS
9RLD 3.0 Å, LolCDE complex with Lpp lipoprotein
9RLG 3.09 Å, LolCDE complex with LolB lipoprotein
9RLF 3.17 Å, LolCDE complex with Pal lipoprotein
9RLE 3.18 Å, LolCDE complex with Pal lipoprotein
9RLH 3.19 Å, LolCDE complex with del 9-15 LolB lipoprotein
7ARJ 3.2 Å, LolCDE in complex with lipoprotein and AMPPNP complex undimerized form
7ARL 3.2 Å, LolCDE in complex with lipoprotein and ADP

Browse structure collections

About this viewer

MolViewer shows 9RLC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.