9RLD: LolCDE complex with Lpp lipoprotein
LolCDE complex with Lpp lipoprotein. Determined by electron microscopy at 3.0 Å resolution. Released 21 Jan 2026.
- Method
- Electron microscopy
- Resolution
- 3.0 Å
- Organism
- Escherichia coli K-12
- Chains
- 5
- Atoms
- 9,844
- Mol. weight
- 149.83 kDa
- Ligands
- Z41, PLM
- Released
- 21 Jan 2026
Explore 9RLD in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9RLD contains 50 α-helices and 57 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain C: 18 helices, 17 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-14 | 10 | |
| α-helix | 21-27 | 7 | |
| α-helix | 29-55 | 27 | |
| α-helix | 56-60 | 5 | |
| β-strand | 66-69 | 4 | 1 |
| β-strand | 75 | 1 | 2 |
| α-helix | 82-84 | 3 | |
| β-strand | 90-96 | 7 | 1 |
| β-strand | 98-104 | 7 | 3 |
| β-strand | 109-117 | 9 | 3 |
| α-helix | 126-128 | 3 | |
| β-strand | 129-130 | 2 | 3 |
| α-helix | 134-136 | 3 | |
| β-strand | 143-147 | 5 | 3 |
| α-helix | 148-154 | 7 | |
| β-strand | 160-161 | 2 | 3 |
| β-strand | 163-165 | 3 | 3 |
| β-strand | 171 | 1 | 4 |
| β-strand | 178 | 1 | 4 |
| β-strand | 181 | 1 | 3 |
| α-helix | 184 | 1 | |
| β-strand | 185-190 | 6 | 3 |
| α-helix | 195-198 | 4 | |
| β-strand | 200-204 | 5 | 3 |
| α-helix | 205-211 | 7 | |
| α-helix | 214-215 | 2 | |
| β-strand | 219 | 1 | 2 |
| β-strand | 221-226 | 6 | 1 |
| α-helix | 235-237 | 3 | |
| α-helix | 240-241 | 2 | |
| β-strand | 245-248 | 4 | 1 |
| α-helix | 250-303 | 54 | |
| α-helix | 307-347 | 41 | |
| α-helix | 362-389 | 28 | |
| α-helix | 392-395 | 4 | |
Chain D: 8 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 4-9 | 6 | 8 |
| β-strand | 13-15 | 3 | 9 |
| β-strand | 22-25 | 4 | 9 |
| β-strand | 31-33 | 3 | 8 |
| β-strand | 37-41 | 5 | 10 |
| α-helix | 50-55 | 6 | |
| β-strand | 65-68 | 4 | 8 |
| β-strand | 72 | 1 | 8 |
| α-helix | 73-75 | 3 | |
| α-helix | 78-88 | 11 | |
| β-strand | 90-92 | 3 | 10 |
| α-helix | 104-114 | 11 | |
| α-helix | 119-133 | 15 | |
| α-helix | 150-160 | 11 | |
| β-strand | 166-170 | 5 | 10 |
| α-helix | 178-194 | 17 | |
| β-strand | 198-203 | 6 | 10 |
| α-helix | 208-211 | 4 | |
| β-strand | 214-218 | 5 | 10 |
| β-strand | 223-224 | 2 | 10 |
Chain E: 16 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-16 | 12 | |
| α-helix | 22-58 | 37 | |
| β-strand | 66-69 | 4 | 5 |
| β-strand | 70 | 1 | 6 |
| α-helix | 78-86 | 9 | |
| β-strand | 91-99 | 9 | 5 |
| β-strand | 102-105 | 4 | 7 |
| β-strand | 111-113 | 3 | 7 |
| β-strand | 114-118 | 5 | 5 |
| α-helix | 120-126 | 7 | |
| α-helix | 129-132 | 4 | |
| β-strand | 133 | 1 | 5 |
| β-strand | 147-151 | 5 | 5 |
| α-helix | 152-158 | 7 | |
| β-strand | 166-170 | 5 | 7 |
| β-strand | 183-187 | 5 | 7 |
| β-strand | 188-193 | 6 | 5 |
| α-helix | 198-202 | 5 | |
| β-strand | 203-207 | 5 | 5 |
| α-helix | 208-214 | 7 | |
| β-strand | 223-228 | 6 | 5 |
| α-helix | 231-233 | 3 | |
| α-helix | 234-244 | 11 | |
| β-strand | 249-251 | 3 | 6 |
| β-strand | 252-253 | 2 | 5 |
| α-helix | 255-297 | 43 | |
| α-helix | 299-308 | 10 | |
| α-helix | 312-343 | 32 | |
| α-helix | 345-356 | 12 | |
| α-helix | 377-403 | 27 | |
| α-helix | 407-411 | 5 | |
Chain F: 8 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 6-9 | 4 | 11 |
| β-strand | 13-15 | 3 | 12 |
| β-strand | 22-25 | 4 | 12 |
| β-strand | 31-32 | 2 | 11 |
| β-strand | 37-41 | 5 | 13 |
| α-helix | 50-55 | 6 | |
| β-strand | 65-68 | 4 | 11 |
| β-strand | 72 | 1 | 11 |
| α-helix | 73-75 | 3 | |
| α-helix | 78-88 | 11 | |
| β-strand | 90-92 | 3 | 13 |
| α-helix | 104-115 | 12 | |
| α-helix | 119-133 | 15 | |
| α-helix | 150-159 | 10 | |
| β-strand | 166-170 | 5 | 13 |
| α-helix | 178-195 | 18 | |
| β-strand | 198-202 | 5 | 13 |
| α-helix | 208-211 | 4 | |
| β-strand | 214-218 | 5 | 13 |
| β-strand | 223-224 | 2 | 13 |
Chain L: 0 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 13-15 | 3 | 6 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Lipoprotein-releasing system transmembrane protein LolC | C | protein | 399 | Escherichia coli K-12 | P0ADC3 (AlphaFold model) |
| Lipoprotein-releasing system transmembrane protein LolE | E | protein | 414 | Escherichia coli K-12 | P75958 (AlphaFold model) |
| Lipoprotein-releasing system ATP-binding protein LolD | D, F | protein | 240 | Escherichia coli K-12 | P75957 (AlphaFold model) |
| Major outer membrane lipoprotein Lpp | L | protein | 69 | Escherichia coli K-12 | P69776 (AlphaFold model) |
Sequence of entity 1 (C), FASTA
>9RLD_1 Lipoprotein-releasing system transmembrane protein LolC (chains C)
MYQPVALFIGLRYMRGRAADRFGRFVSWLSTIGITLGVMALVTVLSVMNGFERELQNNIL
GLMPQAILSSEHGSLNPQQLPETAVKLDGVNRVAPITTGDVVLQSARSVAVGVMLGIDPA
QKDPLTPYLVNVKQTDLEPGKYNVILGEQLASQLGVNRGDQIRVMVPSASQFTPMGRIPS
QRLFNVIGTFAANSEVDGYEMLVNIEDASRLMRYPAGNITGWRLWLDEPLKVDSLSQQKL
PEGSKWQDWRDRKGELFQAVRMEKNMMGLLLSLIVAVAAFNIITSLGLMVMEKQGEVAIL
QTQGLTPRQIMMVFMVQGASAGIIGAILGAALGALLASQLNNLMPIIGVLLDGAALPVAI
EPLQVIVIALVAMAIALLSTLYPSWRAAATQPAEALRYE
Sequence of entity 2 (E), FASTA
>9RLD_2 Lipoprotein-releasing system transmembrane protein LolE (chains E)
MAMPLSLLIGLRFSRGRRRGGMVSLISVISTIGIALGVAVLIVGLSAMNGFERELNNRIL
AVVPHGEIEAVDQPWTNWQEALDHVQKVPGIAAAAPYINFTGLVESGANLRAIQVKGVNP
QQEQRLSALPSFVQGDAWRNFKAGEQQIIIGKGVADALKVKQGDWVSIMIPNSNPEHKLM
QPKRVRLHVAGILQLSGQLDHSFAMIPLADAQQYLDMGSSVSGIALKMTDVFNANKLVRD
AGEVTNSYVYIKSWIGTYGYMYRDIQMIRAIMYLAMVLVIGVACFNIVSTLVMAVKDKSG
DIAVLRTLGAKDGLIRAIFVWYGLLAGLFGSLCGVIIGVVVSLQLTPIIEWIEKLIGHQF
LSSDIYFIDFLPSELHWLDVFYVLVTALLLSLLASWYPARRASNIDPARVLSGQ
Sequence of entity 3 (D, F), FASTA
>9RLD_3 Lipoprotein-releasing system ATP-binding protein LolD (chains D, F)
MNKILLQCDNLCKRYQEGSVQTDVLHNVSFSVGEGEMMAIVGSSGSGKSTLLHLLGGLDT
PTSGDVIFNGQPMSKLSSAAKAELRNQKLGFIYQFHHLLPDFTALENVAMPLLIGKKKPA
EINSRALEMLKAVGLDHRANHRPSELSGGERQRVAIARALVNNPRLVLADEPTGNLDARN
ADSIFQLLGELNRLQGTAFLVVTHDLQLAKRMSRQLEMRDGRLTAELSLMGAEGSHHHHH
Sequence of entity 4 (L), FASTA
>9RLD_4 Major outer membrane lipoprotein Lpp (chains L)
CSSNAKIDQLSSDVQTLNAKVDQLSNDVNAMRSDVQAAKDDAARANQRLDNMATKYRLES
AWSHPQFEK
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| Z41 | (2S)-3-hydroxypropane-1,2-diyl dihexadecanoate | C35 H68 O5 | 1 |
| PLM | Palmitic acid | C16 H32 O2 | 1 |
Primary citation
Liganded LolCDE structures reveal a common substrate-LolE interaction guiding bacterial lipoprotein transport. Szewczyk, P., Greene, N.P., Symmons, M.F. et al. Proc Natl Acad Sci U S A (2026) 123:e2520579123-e2520579123. DOI 10.1073/pnas.2520579123 · PubMed
Other PDB entries of the same protein (UniProt P0ADC3 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 5NAA 1.88 Å, Lipoprotein-releasing system transmembrane protein LolC
- 6F3Z 2.0 Å, Complex of E. coli LolA and periplasmic domain of LolC
- 6F49 2.02 Å, Periplasmic domain of LolC lacking the Hook.
- 9RLC 2.8 Å, LolCDE complex with Lpp lipoprotein
- 9XRO 2.88 Å, LolCDE in complex with SMT-738_3
- 9RLJ 2.9 Å, LolCDE with bound ATPgammaS
- 9RLG 3.09 Å, LolCDE complex with LolB lipoprotein
- 9RLF 3.17 Å, LolCDE complex with Pal lipoprotein
- 9RLE 3.18 Å, LolCDE complex with Pal lipoprotein
- 9RLH 3.19 Å, LolCDE complex with del 9-15 LolB lipoprotein
- 7ARJ 3.2 Å, LolCDE in complex with lipoprotein and AMPPNP complex undimerized form
- 7ARL 3.2 Å, LolCDE in complex with lipoprotein and ADP
Browse structure collections
About this viewer
MolViewer shows 9RLD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.