9RV5: SPSB2 SPRY domain

Crystal structure of SPSB2 SPRY domain in complex with linear TAT peptide. Determined by X-ray diffraction at 1.75 Å resolution. Released 6 Aug 2025.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,405
Mol. weight: 52.82 kDa
Released: 6 Aug 2025

Explore 9RV5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9RV5 contains 14 α-helices and 36 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 7 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	24-26	3
α-helix	29-34	6
α-helix	36-39	4
α-helix	40-45	6
β-strand	48-53	6	1
β-strand	57-60	4	2
α-helix	61-63	3
β-strand	65-68	4	2
β-strand	75-80	6	1
β-strand	84	1	3
β-strand	88-94	7	2
α-helix	97-99	3
β-strand	105-109	5	1
β-strand	116-117	2	1
β-strand	130-134	5	1
β-strand	139	1	4
β-strand	140-141	2	1
α-helix	149-150	2
β-strand	151	1	4
β-strand	166-172	7	2
β-strand	177-182	6	2
β-strand	185-191	7	2
β-strand	199	1	3
β-strand	200-205	6	1
β-strand	211-218	8	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SPRY domain-containing SOCS box protein 2	A, C	protein	217	Homo sapiens	Q99619 (AlphaFold model)
Tat Peptide	B, D	protein	20	Homo sapiens

Sequence of entity 1 (A, C), FASTA

>9RV5_1 SPRY domain-containing SOCS box protein 2 (chains A, C)
MHHHHHHSSGVDLGTENLYFQSMPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEG
GLYFERRPVAQSTDGARGKRGYSRGLHAWEISWPLEQRGTHAVVGVATALAPLQTDHYAA
LLGSNSESWGWDIGRGKLYHQSKGPGAPQYPAGTQGEQLEVPERLLVVLDMEEGTLGYAI
GGTYLGPAFRGLKGRTLYPAVSAVWGQCQVRIRYLGE

Sequence of entity 2 (B, D), FASTA

>9RV5_2 Tat Peptide (chains B, D)
YGRKKRRQRRRGSGVDINNN

Primary citation

Crystal structure of SPSB2 SPRY domain in complex with linear TAT peptide. Lenz, C., Knapp, S., Kraemer, A. et al. To be published.

Other PDB entries of the same protein (UniProt Q99619 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6JWM 1.23 Å, Crystal structure of the SPRY domain of SPSB2 in complex with cR7, a potent cyclic…
6KEY 1.24 Å, Structural basis for the regulation of inducible nitric oxide synthase (iNOS) by the…
5XN3 1.34 Å, Crystal structure of SPSB2 in complex with a rational designed RGD containing cyclic…
6DN6 1.59 Å, SPRY domain-containing SOCS box protein 2 complexed with INNN(ABU) cyclic peptide…
6JWN 1.61 Å, Crystal structure of the SPRY domain of SPSB2 in complex with cR9, a cyclic peptide…
3EMW 1.8 Å, Crystal Structure of human splA/ryanodine receptor domain and SOCS box containing 2…
6JKJ 1.9 Å, Crystal structure of human SPSB2 in the apo-state
6DN5 2.4 Å, SPRY domain-containing SOCS box protein 2 complexed with WDINNN(BAL) cyclic peptide…

Browse structure collections

About this viewer

MolViewer shows 9RV5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.