9RX7: VPS34-CI

VPS34-CI bound to NRBF2 MIT domain (residues 1-79). Determined by electron microscopy at 3.33 Å resolution. Released 22 Jul 2026.

Method: Electron microscopy
Resolution: 3.33 Å
Organism: Homo sapiens
Chains: 6
Atoms: 22,211
Mol. weight: 429.35 kDa
Ligands: GDP, MG, MYR, ZN
Released: 22 Jul 2026

Explore 9RX7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9RX7 contains 146 α-helices and 90 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 44 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	9-10	2	1
β-strand	18-27	10	2
α-helix	35-38	4
α-helix	42-46	5
β-strand	47	1	3
β-strand	58-65	8	4
β-strand	68-69	2	4
β-strand	74-75	2	4
α-helix	76-78	3
β-strand	85-96	12	2
α-helix	97-99	3
β-strand	104-113	10	4
β-strand	114	1	3
β-strand	119-128	10	4
β-strand	130	1	5
α-helix	135	1
β-strand	136	1	5
α-helix	137	1
β-strand	140-145	6	2
β-strand	146-147	2	4
α-helix	150-152	3
α-helix	174-177	4
α-helix	179-183	5
α-helix	194-200	7
α-helix	205-211	7
β-strand	215-220	6	2
β-strand	223-226	4	6
β-strand	229-231	3	6
β-strand	232-233	2	1
α-helix	265-274	10
α-helix	280-282	3
α-helix	290-300	11
α-helix	310-318	9
α-helix	322-325	4
α-helix	329-334	6
α-helix	342-352	11
α-helix	356-357	2
α-helix	360-363	4
α-helix	364-367	4
α-helix	374-382	9
α-helix	397-401	5
α-helix	402-405	4
α-helix	409-412	4
α-helix	476-483	8
α-helix	487-500	14
α-helix	504-509	6
α-helix	511-529	19
α-helix	533-560	28
α-helix	566-577	12
α-helix	580-583	4
β-strand	591-592	2	7
β-strand	600-611	12	7
β-strand	619-625	7	7
β-strand	630-637	8	7
α-helix	642-660	19
β-strand	672-674	3	7
β-strand	679-683	5	7
β-strand	688-689	2	8
α-helix	690-696	7
α-helix	700-707	8
β-strand	709	1	9
α-helix	714-716	3
β-strand	717	1	9
α-helix	719-739	21
β-strand	749-751	3	8
β-strand	757-759	3	8
α-helix	781-787	7
α-helix	793-809	17
α-helix	813-821	9
α-helix	822-824	3
α-helix	829-832	4
α-helix	838-843	6
α-helix	852-870	19

Chain B: 71 helices, 48 β-strands

Element	Residues	Length	Sheet
α-helix	16-19	4
β-strand	31-34	4	10
β-strand	39-44	6	10
β-strand	49-56	8	10
α-helix	65-77	13
α-helix	78-80	3
β-strand	84	1	11
β-strand	89-91	3	10
β-strand	98-104	7	10
β-strand	108	1	12
α-helix	110-114	5
α-helix	119-120	2
α-helix	122-142	21
α-helix	151-153	3
β-strand	156	1	12
β-strand	162	1	12
β-strand	164	1	11
β-strand	175	1	13
α-helix	181-186	6
α-helix	199-201	3
β-strand	202	1	13
α-helix	205-214	10
α-helix	238-252	15
α-helix	261-268	8
α-helix	275-278	4
α-helix	284-293	10
α-helix	298-300	3
α-helix	301-303	3
α-helix	304-310	7
β-strand	312	1	14
β-strand	316	1	14
α-helix	318-319	2
α-helix	320-324	5
α-helix	325-328	4
α-helix	339-348	10
α-helix	350-356	7
α-helix	375-383	9
α-helix	392-404	13
α-helix	411-417	7
α-helix	419-424	6
α-helix	425-427	3
α-helix	431-444	14
α-helix	445-447	3
α-helix	458	1
α-helix	459-463	5
α-helix	464-466	3
α-helix	468-472	5
α-helix	476-484	9
α-helix	486-509	24
α-helix	522-544	23
α-helix	550-559	10
α-helix	561-568	8
α-helix	570-572	3
α-helix	573-577	5
α-helix	578-581	4
α-helix	582-586	5
α-helix	592-599	8
α-helix	602-608	7
α-helix	610-612	3
α-helix	613-623	11
α-helix	629-645	17
α-helix	650-660	11
α-helix	661-665	5
α-helix	669-685	17
α-helix	688-690	3
α-helix	691-695	5
α-helix	696-699	4
α-helix	700-702	3
β-strand	703	1	15
α-helix	713-716	4
β-strand	720	1	15
α-helix	722-725	4
α-helix	726-733	8
α-helix	738-753	16
α-helix	760-762	3
α-helix	765-776	12
α-helix	781-788	8
α-helix	791-800	10
α-helix	802-808	7
β-strand	818-820	3	6
α-helix	821-824	4
β-strand	829	1	1
α-helix	941-961	21
α-helix	962-964	3
α-helix	974-976	3
β-strand	985-989	5	16
β-strand	996-1001	6	17
β-strand	1007-1012	6	17
β-strand	1017-1021	5	17
α-helix	1022-1026	5
β-strand	1036-1038	3	17
β-strand	1045-1051	7	18
β-strand	1056-1061	6	18
β-strand	1065-1069	5	18
β-strand	1084-1089	6	18
β-strand	1100-1105	6	19
β-strand	1110-1115	6	19
β-strand	1120-1125	6	19
β-strand	1134-1136	3	19
α-helix	1139-1141	3
β-strand	1146-1149	4	20
β-strand	1155-1159	5	20
β-strand	1164-1169	6	20
β-strand	1174-1180	7	20
β-strand	1187-1192	6	21
β-strand	1199-1204	6	21
β-strand	1209-1214	6	21
β-strand	1219-1225	7	21
α-helix	1230	1
β-strand	1242-1249	8	22
β-strand	1254-1260	7	22
β-strand	1265-1269	5	22
α-helix	1273-1275	3
β-strand	1278	1	22
β-strand	1289-1295	7	21
β-strand	1298-1304	7	21
β-strand	1332-1339	8	16
β-strand	1343-1349	7	16
β-strand	1354-1357	4	16

Chain C: 14 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	111-126	16
β-strand	136	1	23
α-helix	140-171	32
α-helix	176-178	3
α-helix	180-188	9
α-helix	194-214	21
α-helix	216-218	3
α-helix	219-264	46
α-helix	269-273	5
β-strand	276-279	4	24
β-strand	282-285	4	24
α-helix	305-321	17
α-helix	323-325	3
β-strand	328-331	4	25
α-helix	334-336	3
β-strand	338-341	4	25
β-strand	348-350	3	25
α-helix	358-360	3
α-helix	366-383	18
β-strand	396-397	2	26
β-strand	402-404	3	26
β-strand	412-414	3	26
α-helix	423-445	23

Chain D: 14 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	54	1	23
α-helix	56-61	6
α-helix	75-99	25
α-helix	102-131	30
α-helix	134-145	12
α-helix	148-186	39
α-helix	190-200	11
α-helix	201-205	5
β-strand	208-210	3	27
β-strand	261-263	3	27
β-strand	269-270	2	27
α-helix	276-280	5
α-helix	298-320	23
α-helix	331-334	4
α-helix	342-359	18
α-helix	360-362	3
α-helix	366-368	3
α-helix	374-382	9

Chain L: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	7-23	17
α-helix	27-43	17
α-helix	52-78	27

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Phosphatidylinositol 3-kinase catalytic subunit type 3	A	protein	887	Homo sapiens	Q8NEB9 (AlphaFold model)
Phosphoinositide 3-kinase regulatory subunit 4	B	protein	1370	Homo sapiens	Q99570 (AlphaFold model)
Beclin-1	C, I	protein	450	Homo sapiens	Q14457 (AlphaFold model)
Beclin 1-associated autophagy-related key regulator	D	protein	493	Homo sapiens	Q6ZNE5 (AlphaFold model)
Nuclear receptor-binding factor 2	L	protein	110	Homo sapiens	Q96F24

Sequence of entity 1 (A), FASTA

>9RX7_1 Phosphatidylinositol 3-kinase catalytic subunit type 3 (chains A)
MGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVT
CQVFAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAV
PVGGTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGRTSSTLSEDQMSRLAKLTK
AHRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDG
DESSPILTSFELVKVPDPQMSMENLVESKHHKLARSLRSGPSDHDLKPNAATRDQLNIIV
SYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALELLGKWKPMDV
EDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQLVQALKYENFDDIKNGLEPTKK
DSQSSVSENVSNSGINSAEIDSSQIITSPLPSVSSPPPASKTKEVPDGENLEQDLCTFLI
SRACKNSTLANYLYWYVIVECEDQDTQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRS
LLAAQQTFVDRLVHLMKAVQRESGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVK
IRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRK
ENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSENGPNGISAE
VMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLN
KEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVK
KVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK

Sequence of entity 2 (B), FASTA

>9RX7_2 Phosphoinositide 3-kinase regulatory subunit 4 (chains B)
GNQLAGIAPSQILSVESYFSDIHDFEYDKSLGSTRFFKVARAKHREGLVVVKVFAIQDPT
LPLTSYKQELEELKIRLNSAQNCLPFQKASEKASEKAAMLFRQYVRDNLYDRISTRPFLN
NIEKRWIAFQILTAVDQAHKSGVRHGDIKTENVMVTSWNWVLLTDFASFKPTYLPEDNPA
DFNYFFDTSRRRTCYIAPERFVDGGMFATELEYMRDPSTPLVDLNSNQRTRGELKRAMDI
FSAGCVIAELFTEGVPLFDLSQLLAYRNGHFFPEQVLNKIEDHSIRELVTQMIHREPDKR
LEAEDYLKQQRGNAFPEIFYTFLQPYMAQFAKETFLSADERILVIRKDLGNIIHNLCGHD
LPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRLSVEILLDRITPY
LLHFSNDSVPRVRAEALRTLTKVLALVKEVPRNDINIYPEYILPGIAHLAQDDATIVRLA
YAENIALLAETALRFLELVQLKNLNMENDPNNEEIDEVTHPNGNYDTELQALHEMVQQKV
VTLLSDPENIVKQTLMENGITRLCVFFGRQKANDVLLSHMITFLNDKNDWHLRGAFFDSI
VGVAAYVGWQSSSILKPLLQQGLSDAEEFVIVKALYALTCMCQLGLLQKPHVYEFASDIA
PFLCHPNLWIRYGAVGFITVVARQISTADVYCKLMPYLDPYITQPIIQIERKLVLLSVLK
EPVSRSIFDYALRSKDITSLFRHLHMRQKKRNGSLPDCPPPEDPAIAQLLKKLLSQGMTE
EEEDKLLALKDFMMKSNKAKANIVDQSHLHDSSQKGVIDLAALGITGRQVDLVKTKQEPD
DKRARKHVKQDSNVNEEWKSMFGSLDPPNMPQALPKGSDQEVIQTGKPPRSESSAGICVP
LSTSSQVPEVTTVQNKKPVIPVLSSTILPSTYQIRITTCKTELQQLIQQKREQCNAERIA
KQMMENAEWESKPPPPGWRPKGLLVAHLHEHKSAVNRIRVSDEHSLFATCSNDGTVKIWN
SQKMEGKTTTTRSILTYSRIGGRVKTLTFCQGSHYLAIASDNGAVQLLGIEASKLPKSPK
IHPLQSRILDQKEDGCVVDMHHFNSGAQSVLAYATVNGSLVGWDLRSSSNAWTLKHDLKS
GLITSFAVDIHQCWLCIGTSSGTMACWDMRFQLPISSHCHPSRARIRRLSMHPLYQSWVI
AAVQGNNEVSMWDMETGDRRFTLWASSAPPLSELQPSPHSVHGIYCSPADGNPILLTAGS
DMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRGP
ESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWKSRPTTASENLYFQ

Sequence of entity 3 (C, I), FASTA

>9RX7_3 Beclin-1 (chains C, I)
MEGSKTSNNSTMQVSFVCQRCSQPLKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEE
ETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTG
DLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQL
QMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQ
LELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSGQFGTINNFRLGRLPSVPVEW
NEINAAWGQTVLLLHALANKMGLKFQRYRLVPYGNHSYLESLTDKSKELPLYCSGGLRFF
WDNKFDHAMVAFLDCVQQFKEEVEKGETRFCLPYRMDVEKGKIEDTGGSGGSYSIKTQFN
SEEQWTKALKFMLTNLKWGLAWVSSQFYNK

Sequence of entity 4 (D), FASTA

>9RX7_4 Beclin 1-associated autophagy-related key regulator (chains D)
MTASPSGKGARALEAPGCGPRPLARDLVDSVDDAEGLYVAVERCPLCNTTRRRLTCAKCV
QSGDFVYFDGRDRERFIDKKERLSRLKSKQEEFQKEVLKAMEGKWITDQLRWKIMSCKMR
IEQLKQTICKGNEEMEKNSEGLLKTKEKNQKLYSRAQRHQEKKEKIQRHNRKLGDLVEKK
TIDLRSHYERLANLRRSHILELTSVIFPIEEVKTGVRDPADVSSESDSAMTSSTVSKLAE
ARRTTYLSGRWVCDDHSGDTSISITGPWISLPNNGDYSAYYSWVEEKKTTQGPDMEQSNP
AYTISAALCYATQLVNILSHILDVNLPKKLCNSEFCGENLSKQKFTRAVKKLNANILYLC
FSQHVNLDQLQPLHTLRNLMYLVSPSSEHLGRSGPFEVRADLEESMEFVDPGVAGESDES
GDERVSDEETDLGTDWENLPSPRFCDIPSQSVEVSQSQSTQASPPIASSSAGGMISSAAA
SVTSWFKAYTGHR

Sequence of entity 5 (L), FASTA

>9RX7_5 Nuclear receptor-binding factor 2 (chains L)
MAHHHHHHSSGSENLYFQGSHMEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAA
YLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQN

Ligands and cofactors

ID	Name	Formula	Copies
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	1
MG	Magnesium ion	Mg	1
MYR	Myristic acid	C14 H28 O2	1
ZN	Zinc ion	Zn	2

Primary citation

When VPS34 complexes double down: Two RAB5s for VPS34-CII, two RAB1s for NRBF2-dimerized VPS34-CI. Spokaite, S., Ohashi, Y., Dessus, A.N. et al. To be published.

Other PDB entries of the same protein (UniProt Q8NEB9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6HOG 1.26 Å, Structure of VPS34 LIR motif bound to GABARAP
7RSP 1.67 Å, Structure of the VPS34 kinase domain with compound 14
7RSV 1.78 Å, Structure of the VPS34 kinase domain with compound 5
7RSJ 1.88 Å, Structure of the VPS34 kinase domain with compound 14
4UWH 1.93 Å, Discovery of (2S)-8-((3R)-3-Methylmorpholin-4-yl)-1-(3-methyl-2-oxo-…
9NIN 2.01 Å, The structure of human Vacuolar Protein Sorting 34 catalytic domain bound to RD-I-86
8RXR 2.06 Å, Crystal structure of VPS34 in complex with inhibitor SB02024
9ORM 2.06 Å, The structure of human Vacuolar Protein Sorting 34 catalytic domain bound to RD-I-137
6I3U 2.09 Å, Optimization of potent and selective ATM inhibitors suitable for a proof-of-concept…
9ZF4 2.09 Å, The structure of human Vacuolar Protein Sorting 34 catalytic domain bound to RD-II-83
9DKP 2.16 Å, The structure of human vacuolar protein sorting 34 catalytic domain bound to RD-I-53
3LS8 2.25 Å, Crystal structure of human PIK3C3 in complex with 3-[4-(4-Morpholinyl)thieno[3,2-d]pyrimi…

Browse structure collections

About this viewer

MolViewer shows 9RX7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.