9RZE: RNA polymerase II subunit D
State 2 MAP 3 RNA Pol II activated elongation complex with SETD2 bound to proximal upstream H3. Determined by electron microscopy at 8.53 Å resolution. Released 18 Mar 2026.
- Method
- Electron microscopy
- Resolution
- 8.53 Å
- Organisms
- Sus scrofa, synthetic construct, Homo sapiens
- Chains
- 34
- Atoms
- 72,793
- Mol. weight
- 1783.8 kDa
- Ligands
- MG, ZN
- Released
- 18 Mar 2026
Explore 9RZE in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9RZE contains 388 α-helices and 395 β-strands across 31 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain a: 5 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 37 | 1 | 51 |
| α-helix | 42-43 | 2 | |
| α-helix | 46-57 | 12 | |
| α-helix | 65-76 | 12 | |
| β-strand | 84-85 | 2 | 94 |
| α-helix | 88-114 | 27 | |
| β-strand | 119-120 | 2 | 95 |
| α-helix | 122-132 | 11 | |
Chain A: 77 helices, 67 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 15-16 | 2 | 23 |
| β-strand | 21-25 | 5 | 104 |
| α-helix | 26-27 | 2 | |
| α-helix | 28-34 | 7 | |
| β-strand | 47-49 | 3 | 105 |
| β-strand | 51-52 | 2 | 105 |
| α-helix | 60-62 | 3 | |
| α-helix | 81-85 | 5 | |
| β-strand | 88 | 1 | 106 |
| β-strand | 94 | 1 | 107 |
| α-helix | 100-109 | 10 | |
| α-helix | 124-132 | 9 | |
| α-helix | 137-147 | 11 | |
| β-strand | 192-194 | 3 | 108 |
| β-strand | 197-199 | 3 | 108 |
| β-strand | 215-216 | 2 | 108 |
| α-helix | 218-227 | 10 | |
| α-helix | 230-235 | 6 | |
| α-helix | 245-248 | 4 | |
| β-strand | 250 | 1 | 107 |
| β-strand | 253 | 1 | 106 |
| β-strand | 264 | 1 | 109 |
| β-strand | 272 | 1 | 109 |
| α-helix | 273-274 | 2 | |
| α-helix | 275-296 | 22 | |
| α-helix | 302-318 | 17 | |
| β-strand | 329-330 | 2 | 110 |
| β-strand | 334-335 | 2 | 110 |
| α-helix | 339-342 | 4 | |
| α-helix | 349-354 | 6 | |
| β-strand | 357-358 | 2 | 111 |
| β-strand | 362-369 | 8 | 112 |
| β-strand | 377-380 | 4 | 112 |
| α-helix | 382-387 | 6 | |
| β-strand | 389-393 | 5 | 113 |
| α-helix | 399-408 | 10 | |
| β-strand | 416-420 | 5 | 113 |
| β-strand | 426-428 | 3 | 113 |
| α-helix | 429-431 | 3 | |
| α-helix | 435-437 | 3 | |
| β-strand | 445-449 | 5 | 113 |
| α-helix | 450 | 1 | |
| β-strand | 455-459 | 5 | 112 |
| α-helix | 466-468 | 3 | |
| β-strand | 471-476 | 6 | 112 |
| β-strand | 482-484 | 3 | 112 |
| α-helix | 486-488 | 3 | |
| α-helix | 489-492 | 4 | |
| β-strand | 500-504 | 5 | 112 |
| α-helix | 509-518 | 10 | |
| β-strand | 520 | 1 | 112 |
| α-helix | 521-524 | 4 | |
| β-strand | 526 | 1 | 114 |
| β-strand | 533 | 1 | 114 |
| α-helix | 540-548 | 9 | |
| β-strand | 554-555 | 2 | 115 |
| α-helix | 557-563 | 7 | |
| α-helix | 564-566 | 3 | |
| α-helix | 574 | 1 | |
| β-strand | 575 | 1 | 48 |
| α-helix | 576-577 | 2 | |
| β-strand | 579-581 | 3 | 49 |
| β-strand | 585 | 1 | 49 |
| β-strand | 586-587 | 2 | 115 |
| α-helix | 588-595 | 8 | |
| β-strand | 602-604 | 3 | 116 |
| β-strand | 628-631 | 4 | 116 |
| β-strand | 634-637 | 4 | 116 |
| α-helix | 642-645 | 4 | |
| α-helix | 652-659 | 8 | |
| α-helix | 662-683 | 22 | |
| β-strand | 686 | 1 | 117 |
| α-helix | 689-691 | 3 | |
| α-helix | 698-721 | 24 | |
| α-helix | 725-728 | 4 | |
| α-helix | 733-759 | 27 | |
| α-helix | 765-771 | 7 | |
| α-helix | 778-781 | 4 | |
| α-helix | 782-786 | 5 | |
| β-strand | 789-790 | 2 | 118 |
| β-strand | 793 | 1 | 119 |
| β-strand | 796 | 1 | 119 |
| α-helix | 798-799 | 2 | |
| β-strand | 822-823 | 2 | 118 |
| α-helix | 833-868 | 36 | |
| β-strand | 872-873 | 2 | 120 |
| β-strand | 879-880 | 2 | 120 |
| β-strand | 886-888 | 3 | 120 |
| α-helix | 891-893 | 3 | |
| β-strand | 896 | 1 | 121 |
| β-strand | 902-905 | 4 | 122 |
| α-helix | 913-920 | 8 | |
| α-helix | 927-933 | 7 | |
| β-strand | 934 | 1 | 123 |
| α-helix | 936-944 | 9 | |
| α-helix | 946-969 | 24 | |
| α-helix | 971-973 | 3 | |
| β-strand | 976-979 | 4 | 122 |
| α-helix | 983-993 | 11 | |
| β-strand | 1002 | 1 | 123 |
| α-helix | 1006-1019 | 14 | |
| α-helix | 1028-1037 | 10 | |
| α-helix | 1039-1048 | 10 | |
| α-helix | 1053-1056 | 4 | |
| α-helix | 1062-1078 | 17 | |
| β-strand | 1080 | 1 | 121 |
| α-helix | 1081-1082 | 2 | |
| α-helix | 1087-1096 | 10 | |
| α-helix | 1098-1100 | 3 | |
| α-helix | 1121-1128 | 8 | |
| β-strand | 1138-1142 | 5 | 124 |
| β-strand | 1143 | 1 | 125 |
| α-helix | 1146-1149 | 4 | |
| α-helix | 1151-1161 | 11 | |
| β-strand | 1164-1165 | 2 | 126 |
| α-helix | 1166-1169 | 4 | |
| β-strand | 1170-1177 | 8 | 58 |
| α-helix | 1181-1183 | 3 | |
| α-helix | 1190-1194 | 5 | |
| β-strand | 1210-1216 | 7 | 58 |
| α-helix | 1218-1222 | 5 | |
| α-helix | 1228-1239 | 12 | |
| β-strand | 1243-1247 | 5 | 58 |
| β-strand | 1255-1261 | 7 | 58 |
| α-helix | 1281-1295 | 15 | |
| β-strand | 1297-1299 | 3 | 126 |
| β-strand | 1306-1310 | 5 | 124 |
| α-helix | 1315-1317 | 3 | |
| β-strand | 1319-1320 | 2 | 127 |
| β-strand | 1330-1331 | 2 | 127 |
| β-strand | 1335-1339 | 5 | 124 |
| α-helix | 1344-1347 | 4 | |
| β-strand | 1352 | 1 | 125 |
| β-strand | 1358 | 1 | 124 |
| α-helix | 1362-1386 | 25 | |
| α-helix | 1395-1404 | 10 | |
| α-helix | 1416-1420 | 5 | |
| α-helix | 1426-1431 | 6 | |
| α-helix | 1437-1444 | 8 | |
| β-strand | 1448-1449 | 2 | 104 |
| α-helix | 1454-1459 | 6 | |
| α-helix | 1467-1469 | 3 | |
| β-strand | 1472-1475 | 4 | 35 |
| α-helix | 1479-1481 | 3 | |
Chain b: 4 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 25-28 | 4 | |
| α-helix | 31-40 | 10 | |
| β-strand | 45-46 | 2 | 95 |
| α-helix | 50-75 | 26 | |
| β-strand | 80-81 | 2 | 94 |
| α-helix | 83-93 | 11 | |
| β-strand | 96-98 | 3 | 96 |
Chain B: 56 helices, 79 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 22-36 | 15 | |
| α-helix | 41-49 | 9 | |
| α-helix | 50-54 | 5 | |
| α-helix | 55-60 | 6 | |
| α-helix | 63-65 | 3 | |
| β-strand | 83-84 | 2 | 2 |
| β-strand | 87-93 | 7 | 2 |
| β-strand | 97-99 | 3 | 3 |
| β-strand | 105-107 | 3 | 3 |
| α-helix | 110-116 | 7 | |
| β-strand | 121-134 | 14 | 2 |
| β-strand | 138-153 | 16 | 2 |
| α-helix | 154-155 | 2 | |
| α-helix | 168-173 | 6 | |
| β-strand | 185-187 | 3 | 4 |
| β-strand | 190-194 | 5 | 4 |
| α-helix | 195 | 1 | |
| β-strand | 196-200 | 5 | 5 |
| α-helix | 201 | 1 | |
| β-strand | 205-208 | 4 | 6 |
| β-strand | 215-223 | 9 | 6 |
| α-helix | 231-232 | 2 | |
| β-strand | 233-240 | 8 | 6 |
| β-strand | 256-258 | 3 | 6 |
| β-strand | 263 | 1 | 7 |
| β-strand | 267-268 | 2 | 6 |
| α-helix | 269-275 | 7 | |
| α-helix | 281-288 | 8 | |
| α-helix | 295-307 | 13 | |
| α-helix | 314-323 | 10 | |
| β-strand | 325 | 1 | 7 |
| α-helix | 332-341 | 10 | |
| α-helix | 342-346 | 5 | |
| α-helix | 349-351 | 3 | |
| α-helix | 358-377 | 20 | |
| α-helix | 381-384 | 4 | |
| α-helix | 388-390 | 3 | |
| β-strand | 391-394 | 4 | 5 |
| α-helix | 396-423 | 28 | |
| α-helix | 440-450 | 11 | |
| β-strand | 453 | 1 | 8 |
| α-helix | 456-461 | 6 | |
| β-strand | 463 | 1 | 8 |
| β-strand | 467-469 | 3 | 4 |
| α-helix | 475-482 | 8 | |
| β-strand | 484-486 | 3 | 5 |
| α-helix | 497-499 | 3 | |
| α-helix | 503-505 | 3 | |
| β-strand | 509 | 1 | 9 |
| β-strand | 523-525 | 3 | 5 |
| β-strand | 526 | 1 | 9 |
| β-strand | 531-532 | 2 | 10 |
| α-helix | 539-547 | 9 | |
| β-strand | 551-552 | 2 | 11 |
| α-helix | 553-555 | 3 | |
| α-helix | 558-561 | 4 | |
| β-strand | 565-569 | 5 | 11 |
| β-strand | 572-577 | 6 | 11 |
| α-helix | 580-593 | 14 | |
| β-strand | 602-606 | 5 | 11 |
| β-strand | 611-615 | 5 | 11 |
| β-strand | 621-627 | 7 | 10 |
| β-strand | 630 | 1 | 12 |
| β-strand | 632 | 1 | 12 |
| α-helix | 637-644 | 8 | |
| β-strand | 646 | 1 | 13 |
| β-strand | 649 | 1 | 13 |
| α-helix | 653-658 | 6 | |
| β-strand | 662-666 | 5 | 10 |
| α-helix | 670-672 | 3 | |
| β-strand | 675-676 | 2 | 10 |
| β-strand | 695-696 | 2 | 10 |
| α-helix | 700-703 | 4 | |
| α-helix | 714-716 | 3 | |
| β-strand | 717 | 1 | 14 |
| α-helix | 719-728 | 10 | |
| β-strand | 732 | 1 | 15 |
| β-strand | 748-751 | 4 | 16 |
| β-strand | 755 | 1 | 63 |
| β-strand | 759-760 | 2 | 17 |
| α-helix | 762-764 | 3 | |
| β-strand | 776-782 | 7 | 18 |
| β-strand | 783 | 1 | 117 |
| β-strand | 794-797 | 4 | 18 |
| α-helix | 798-802 | 5 | |
| β-strand | 808-817 | 10 | 16 |
| β-strand | 819-820 | 2 | 19 |
| β-strand | 826-829 | 4 | 19 |
| β-strand | 837-838 | 2 | 19 |
| α-helix | 845-847 | 3 | |
| β-strand | 853 | 1 | 20 |
| α-helix | 854-855 | 2 | |
| β-strand | 859 | 1 | 16 |
| β-strand | 865-867 | 3 | 20 |
| β-strand | 869-872 | 4 | 19 |
| β-strand | 889-891 | 3 | 19 |
| β-strand | 894-895 | 2 | 20 |
| α-helix | 896-897 | 2 | |
| β-strand | 903-911 | 9 | 16 |
| β-strand | 917-927 | 11 | 16 |
| β-strand | 934-937 | 4 | 18 |
| β-strand | 943-949 | 7 | 18 |
| β-strand | 956 | 1 | 21 |
| β-strand | 965-967 | 3 | 18 |
| α-helix | 969-971 | 3 | |
| α-helix | 972-975 | 4 | |
| β-strand | 977 | 1 | 14 |
| α-helix | 978-993 | 16 | |
| β-strand | 997-998 | 2 | 17 |
| α-helix | 1008-1015 | 8 | |
| α-helix | 1016-1018 | 3 | |
| β-strand | 1025-1026 | 2 | 18 |
| β-strand | 1029 | 1 | 21 |
| α-helix | 1035 | 1 | |
| β-strand | 1036 | 1 | 21 |
| α-helix | 1037 | 1 | |
| α-helix | 1040 | 1 | |
| β-strand | 1041-1050 | 10 | 18 |
| β-strand | 1051 | 1 | 15 |
| α-helix | 1055-1057 | 3 | |
| β-strand | 1060 | 1 | 112 |
| β-strand | 1067 | 1 | 22 |
| β-strand | 1074 | 1 | 22 |
| β-strand | 1085-1086 | 2 | 111 |
| α-helix | 1088-1097 | 10 | |
| α-helix | 1100-1104 | 5 | |
| α-helix | 1105-1109 | 5 | |
| β-strand | 1113-1119 | 7 | 23 |
| β-strand | 1126 | 1 | 23 |
| β-strand | 1127 | 1 | 24 |
| α-helix | 1128 | 1 | |
| β-strand | 1136 | 1 | 24 |
| β-strand | 1146-1152 | 7 | 23 |
| α-helix | 1153-1163 | 11 | |
| β-strand | 1167-1170 | 4 | 104 |
Chain c: 5 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 17-21 | 5 | |
| α-helix | 28-35 | 8 | |
| β-strand | 42-43 | 2 | 97 |
| α-helix | 47-72 | 26 | |
| β-strand | 77-78 | 2 | 98 |
| α-helix | 80-88 | 9 | |
| α-helix | 91-96 | 6 | |
| β-strand | 101-102 | 2 | 99 |
Chain C: 11 helices, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 8-14 | 7 | 30 |
| β-strand | 18-24 | 7 | 30 |
| α-helix | 28-39 | 12 | |
| β-strand | 44-55 | 12 | 31 |
| α-helix | 61-69 | 9 | |
| β-strand | 73 | 1 | 32 |
| α-helix | 82-84 | 3 | |
| α-helix | 85-87 | 3 | |
| β-strand | 98-106 | 9 | 31 |
| α-helix | 112 | 1 | |
| β-strand | 113-115 | 3 | 33 |
| α-helix | 117-119 | 3 | |
| β-strand | 121-122 | 2 | 31 |
| β-strand | 129 | 1 | 32 |
| β-strand | 151-153 | 3 | 33 |
| β-strand | 158-168 | 11 | 31 |
| α-helix | 174-176 | 3 | |
| β-strand | 179-182 | 4 | 30 |
| β-strand | 185-186 | 2 | 30 |
| α-helix | 200-202 | 3 | |
| α-helix | 204-206 | 3 | |
| α-helix | 218-220 | 3 | |
| β-strand | 229-235 | 7 | 30 |
| α-helix | 241-268 | 28 | |
Chain d: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 38-48 | 11 | |
| β-strand | 53-54 | 2 | 98 |
| α-helix | 56-83 | 28 | |
| β-strand | 88-89 | 2 | 97 |
| α-helix | 91-101 | 11 | |
| α-helix | 105-122 | 18 | |
Chain D: 9 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 16 | 1 | 1 |
| α-helix | 24-26 | 3 | |
| α-helix | 34-49 | 16 | |
| α-helix | 55-58 | 4 | |
| α-helix | 59-70 | 12 | |
| α-helix | 77-88 | 12 | |
| α-helix | 96-102 | 7 | |
| α-helix | 108-114 | 7 | |
| α-helix | 116-118 | 3 | |
| α-helix | 124-135 | 12 | |
23 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| RNA polymerase II subunit D | D | protein | 142 | Sus scrofa | A0A287ADR4 (AlphaFold model) |
| DNA-directed RNA polymerase II subunit E | E | protein | 210 | Sus scrofa | I3LSI7 (AlphaFold model) |
| DNA-directed RNA polymerases I, II, and III subunit RPABC2 | F | protein | 127 | Sus scrofa | A0A8D1KNW4 (AlphaFold model) |
| DNA-directed RNA polymerase II subunit RPB7 | G | protein | 172 | Sus scrofa | A0A4X1VKG7 (AlphaFold model) |
| DNA-directed RNA polymerases I, II, and III subunit RPABC3 | H | protein | 150 | Sus scrofa | I3LCB2 |
| DNA-directed RNA polymerase II subunit RPB9 | I | protein | 125 | Sus scrofa | P60899 |
| DNA-directed RNA polymerases I, II, and III subunit RPABC5 | J | protein | 67 | Sus scrofa | A0A4X1VYD0 |
| DNA-directed RNA polymerase II subunit RPB11-a | K | protein | 117 | Sus scrofa | F1RKE4 |
| RNA polymerase II subunit K | L | protein | 58 | Sus scrofa | A0A8D0JYF1 |
| RNA (92-mer) | P | RNA | 46 | synthetic construct | |
| RNA polymerase-associated protein CTR9 homolog | Q | protein | 1179 | Homo sapiens | Q6PD62 |
| Template DNA | T | DNA | 182 | synthetic construct | |
18 more molecules are not listed.
Sequence of entity 1 (D), FASTA
>9RZE_1 RNA polymerase II subunit D (chains D)
MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEV
FMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEG
RFEDEELQQILDDIQTKRSFQY
Sequence of entity 2 (E), FASTA
>9RZE_2 DNA-directed RNA polymerase II subunit E (chains E)
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVA
RYFGIKRGQVVKIIRPSETAGRYITYRLVQ
Sequence of entity 3 (F), FASTA
>9RZE_3 DNA-directed RNA polymerases I, II, and III subunit RPABC2 (chains F)
MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKY
ERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGV
DELIISD
Sequence of entity 4 (G), FASTA
>9RZE_4 DNA-directed RNA polymerase II subunit RPB7 (chains G)
MFYHISLEHEILLHPRYFGPNLLNTVKQKLFTEVEGTCTGKYGFVIAVTTIDNIGAGVIQ
PGRGFVLYPVKYKAIVFRPFKGEVVDAVVTQVNKVGLFTEIGPMSCFISRHSIPSEMEFD
PNSNPPCYKTMDEDIVIQQDDEIRLKIVGTRVDKNDIFAIGSLMDDYLGLVS
Sequence of entity 5 (H), FASTA
>9RZE_5 DNA-directed RNA polymerases I, II, and III subunit RPABC3 (chains H)
MAGILFEDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVI
ASTLYEDGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGG
LLMRLQGDANNLHGFEVDSRVYLLMKKLAF
Sequence of entity 6 (I), FASTA
>9RZE_6 DNA-directed RNA polymerase II subunit RPB9 (chains I)
MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITH
EVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCG
HRWTE
Sequence of entity 7 (J), FASTA
>9RZE_7 DNA-directed RNA polymerases I, II, and III subunit RPABC5 (chains J)
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLL
NYAPLEK
Sequence of entity 8 (K), FASTA
>9RZE_8 DNA-directed RNA polymerase II subunit RPB11-a (chains K)
MNAPPAFESFLLFEGEKKITINKDTKVPNACLFTINKEDHTLGNIIKSQLLKDPQVLFAG
YKVPHPLEHKIIIRVQTTPDYSPQEAFTNAITDLISELSLLEERFRVAIKDKQEGIE
Sequence of entity 9 (L), FASTA
>9RZE_9 RNA polymerase II subunit K (chains L)
MDTQKDVQPPKQQPMIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR
Sequence of entity 10 (P), FASTA
>9RZE_10 RNA (92-MER) (chains P)
UUAAGGAAUUAAGUCGUGCGUCUAAUAACCGGAGAGGGAACCCACU
Sequence of entity 11 (Q), FASTA
>9RZE_11 RNA polymerase-associated protein CTR9 homolog (chains Q)
MSRGSIEIPLRDTDEVIELDFDQLPEGDEVISILKQEHTQLHIWIALALEYYKQGKTEEF
VKLLEAARIDGNLDYRDHEKDQMTCLDTLAAYYVQQARKEKNKDNKKDLITQATLLYTMA
DKIIMYDQNHLLGRACFCLLEGDKMDQADAQFHFVLNQSPNNIPALLGKACISFNKKDYR
GALAYYKKALRTNPGCPAEVRLGMGHCFVKLNKLEKARLAFSRALELNSKCVGALVGLAV
LELNNKEADSIKNGVQLLSRAYTIDPSNPMVLNHLANHFFFKKDYSKVQHLALHAFHNTE
VEAMQAESCYQLARSFHVQEDYDQAFQYYYQATQFASSSFVLPFFGLGQMYIYRGDKENA
SQCFEKVLKAYPNNYETMKILGSLYAASEDQEKRDIAKGHLKKVTEQYPDDVEAWIELAQ
ILEQTDIQGALSAYGTATRILQEKVQADVPPEILNNVGALHFRLGNLGEAKKYFLASLDR
AKAEAEHDEHYYNAISVTTSYNLARLYEAMCEFHEAEKLYKNILREHPNYVDCYLRLGAM
ARDKGNFYEASDWFKEALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPSTQSD
TYSMLALGNVWLQTLHQPTRDREKEKRHQDRALAIYKQVLRNDAKNLYAANGIGAVLAHK
GYFREARDVFAQVREATADISDVWLNLAHIYVEQKQYISAVQMYENCLRKFYKHQNTEVV
LYLARALFKCGKLQECKQTLLKARHVAPSDTVLMFNVALVLQRLATSVLKDEKSNLKEVL
NAVKELELAHRYFSYLSKVGDKMRFDLALAATEARQCSDLLSQAQYHVARARKQDEEERE
LRAKQEQEKELLRQKLLKEQEEKRLREKEEQKKLLEQRAQYVEKTKNILMFTGETEATKE
KKRGGGGGRRSKKGGEFDEFVNDDTDDDLPISKKKKRRKGSGSEQEGEDEEGGERKKKKR
RRHPKGEEGSDDDETENGPKPKKRRPPKAEKKKAPKPERLPPSMKGKIKSKAIISSSDDS
SDEDKLKIADEGHPRNSNSNSDSDEDEQRKKCASSESDSDENQNKSGSEAGSPRRPRRQR
SDQDSDSDQPSRKRRPSGSEQSDNESVQSGRSHSGVSENDSRPASPSAESDHESERGSDN
EGSGQGSGNESEPEGSNNEASDRGSEHGSDDSDENLYFQ
Sequence of entity 12 (T), FASTA
>9RZE_12 Template DNA (chains T)
GCTCCCAGCTCCCTGCTGGCTCCGAGTGGGTTCTGCCGCGACAGTGATGGTGCCGAGGCC
GCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCCCCGC
GTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCG
AT
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| MG | Magnesium ion | Mg | 1 |
| ZN | Zinc ion | Zn | 9 |
Primary citation
Molecular mechanism of co-transcriptional H3K36 methylation by SETD2. Walshe, J.L., Ochmann, M., Neef, U. et al. Nat Commun (2025) 16:9565-9565. DOI 10.1038/s41467-025-65439-y · PubMed
Other PDB entries of the same protein (UniProt A0A287ADR4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 9BZ0 1.9 Å, Structure of an STK19-containing TC-NER complex
- 7NVU 2.5 Å, RNA polymerase II core pre-initiation complex with open promoter DNA
- 7OOB 2.7 Å, Pol II-CSB-CSA-DDB1-UVSSA-ADPBeF3 (Structure2)
- 7F4G 2.78 Å, Structure of RPAP2-bound RNA polymerase II
- 7NVS 2.8 Å, RNA polymerase II core pre-initiation complex with closed promoter DNA in proximal…
- 7OO3 2.8 Å, Pol II-CSB-CSA-DDB1-UVSSA (Structure1)
- 8OEW 2.8 Å, Structure of the mammalian Pol II-Elongin complex, lacking the ELOA latch (composite…
- 8UHD 2.8 Å, Structure of paused transcription complex Pol II-DSIF-NELF - post-translocated
- 8OEV 2.86 Å, Structure of the mammalian Pol II-SPT6-Elongin complex, lacking ELOA latch (composite…
- 7NVT 2.9 Å, RNA polymerase II core pre-initiation complex with closed promoter DNA in distal position
- 7OOP 2.9 Å, Pol II-CSB-CSA-DDB1-UVSSA-PAF-SPT6 (Structure 3)
- 8S52 2.9 Å, RNA polymerase II core initially transcribing complex with an ordered RNA of 10 nt
Browse structure collections
About this viewer
MolViewer shows 9RZE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.