Crystal structure of the human tumor necrosis factor receptor 1 extracellular domain at 1.64A resolution. Determined by X-ray diffraction at 1.64 Å resolution. Released 1 Jul 2026.
Explore 9S3I in 3D Show helices and sheets RCSB PDB PDBe
9S3I contains 18 α-helices and 40 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 16 | 1 | |
| β-strand | 19-22 | 4 | 1 |
| β-strand | 25-31 | 7 | 1 |
| α-helix | 32 | 1 | |
| β-strand | 33 | 1 | 2 |
| α-helix | 34 | 1 | |
| β-strand | 37-41 | 5 | 3 |
| β-strand | 48 | 1 | 4 |
| α-helix | 49-50 | 2 | |
| β-strand | 51-54 | 4 | 3 |
| α-helix | 55-56 | 2 | |
| β-strand | 59-60 | 2 | 5 |
| β-strand | 65 | 1 | 2 |
| α-helix | 70 | 1 | |
| β-strand | 71-72 | 2 | 5 |
| α-helix | 73-76 | 4 | |
| α-helix | 78-80 | 3 | |
| β-strand | 83-86 | 4 | 6 |
| β-strand | 89 | 1 | 7 |
| β-strand | 92 | 1 | 7 |
| β-strand | 95-97 | 3 | 6 |
| β-strand | 102-106 | 5 | 8 |
| β-strand | 112-116 | 5 | 8 |
| α-helix | 117-119 | 3 | |
| β-strand | 124-127 | 4 | 9 |
| β-strand | 130 | 1 | 10 |
| β-strand | 133 | 1 | 10 |
| α-helix | 134-135 | 2 | |
| β-strand | 136-138 | 3 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 19-21 | 3 | 11 |
| β-strand | 29-31 | 3 | 11 |
| α-helix | 32 | 1 | |
| β-strand | 33 | 1 | 12 |
| α-helix | 34 | 1 | |
| β-strand | 37-41 | 5 | 13 |
| β-strand | 48 | 1 | 4 |
| α-helix | 49-50 | 2 | |
| β-strand | 51-54 | 4 | 13 |
| α-helix | 55-56 | 2 | |
| β-strand | 59-60 | 2 | 14 |
| β-strand | 65 | 1 | 12 |
| α-helix | 70 | 1 | |
| β-strand | 71-72 | 2 | 14 |
| α-helix | 73-76 | 4 | |
| α-helix | 78-80 | 3 | |
| β-strand | 83-86 | 4 | 15 |
| β-strand | 89 | 1 | 16 |
| β-strand | 92 | 1 | 16 |
| β-strand | 95-97 | 3 | 15 |
| β-strand | 102-106 | 5 | 17 |
| β-strand | 112-116 | 5 | 17 |
| α-helix | 117-119 | 3 | |
| β-strand | 123-127 | 5 | 18 |
| β-strand | 130 | 1 | 19 |
| β-strand | 133 | 1 | 19 |
| β-strand | 136-139 | 4 | 18 |
| β-strand | 144-145 | 2 | 20 |
| β-strand | 150-151 | 2 | 20 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tumor necrosis factor receptor superfamily member 1A, membrane form | A, B | protein | 164 | Homo sapiens | P19438 (AlphaFold model) |
>9S3I_1 Tumor necrosis factor receptor superfamily member 1A, membrane form (chains A, B) GPRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLR HCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLS CQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN
| ID | Name | Formula | Copies |
|---|---|---|---|
| PO4 | Phosphate ion | O4 P | 7 |
Discovery of Ligands for the TNFR1 Extracellular Domain Using Fragment-Based Drug Discovery. Chedotal, H., Povlsen, K., Narayanan, D. et al. ChemMedChem (2026) 21:e70365-e70365. DOI 10.1002/cmdc.70365 · PubMed
Other PDB entries of the same protein (UniProt P19438 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9S3I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.