9S6E: Human caspase-9 CARD (H38R) mutant filament

Cryo-EM structure of human caspase-9 CARD (H38R) mutant filament. Determined by electron microscopy at 3.5 Å resolution. Released 12 Aug 2026.

Method: Electron microscopy
Resolution: 3.5 Å
Organism: Homo sapiens
Chains: 16
Atoms: 12,608
Mol. weight: 180.86 kDa
Released: 12 Aug 2026

Explore 9S6E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9S6E contains 116 α-helices and 0 β-strands across 16 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, E, F, G, H, I, L, M, N, O and P: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	3-11	9
α-helix	13-18	6
α-helix	25-31	7
α-helix	37-44	8
α-helix	51-62	12
α-helix	69-80	12
α-helix	83-94	12

Chains C, D, J and K: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	3-11	9
α-helix	13-18	6
α-helix	25-31	7
α-helix	37-44	8
α-helix	51-61	11
α-helix	62-64	3
α-helix	69-80	12
α-helix	83-94	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Caspase-9	A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P	protein	97	Homo sapiens	P55211 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P), FASTA

>9S6E_1 Caspase-9 (chains A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P)
SGMDEADRRLLRRCRLRLVEELQVDQLWDALLSRELFRPRMIEDIQRAGSGSRRDQARQL
IIDLETRGSQALPLFISCLEDTGQDMLASFLRTNRQA

Primary citation

Cryo-EM structure of Caspase-9 CARD (H38R) mutant filament. Rawal, S., Bohn, S., Alderson, T.R. et al. To be published.

Other PDB entries of the same protein (UniProt P55211 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3D9T 1.5 Å, CIAP1-BIR3 in complex with N-terminal peptide from Caspase-9 (ATPFQE)
4RHW 2.1 Å, Crystal structure of Apaf-1 CARD and caspase-9 CARD complex
1NW9 2.4 Å, Structure of caspase-9 in an inhibitory complex with xiap-BIR3
9R44 2.46 Å, Crystal structure of human caspase-9 CARD
3YGS 2.5 Å, Apaf-1 card in complex with prodomain of procaspase-9
1JXQ 2.8 Å, Structure of cleaved, CARD domain deleted Caspase-9
2AR9 2.8 Å, Crystal structure of a dimeric caspase-9
5WVC 2.99 Å, Structure of the CARD-CARD disk
9S6F 3.3 Å, Cryo-EM structure of human caspase-9 CARD (WT) filament
3V3K 3.49 Å, Human caspase 9 in complex with bacterial effector protein
5JUY 4.1 Å, Active human apoptosome with procaspase-9
5WVE 4.4 Å, Apaf-1-Caspase-9 holoenzyme

Browse structure collections

About this viewer

MolViewer shows 9S6E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.