9S9X: Human WASP/WIP complex

Human WASP/WIP complex. Determined by solution NMR. Released 19 Aug 2026.

Method: Solution NMR
Organism: Homo sapiens
Chains: 2
Atoms: 1,574
Mol. weight: 22.33 kDa
Released: 19 Aug 2026

Explore 9S9X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9S9X contains 4 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	29-38	10
β-strand	44-56	13	1
β-strand	64-76	13	1
β-strand	84-88	5	1
β-strand	97	1	1
β-strand	100	1	1
β-strand	114-118	5	1
β-strand	123-128	6	1
α-helix	131-149	19

Chain B: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	445	1	2
α-helix	447-452	6
α-helix	476-481	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Actin nucleation-promoting factor WAS	A	protein	141	Homo sapiens	P42768 (AlphaFold model)
WAS/WASL-interacting protein family member 1	B	protein	53	Homo sapiens	O43516 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9S9X_1 Actin nucleation-promoting factor WAS (chains A)
SGQNIPSTLLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPGAEHWTKEHCGAVCFVKD
NPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGDDCQAGLNFADEDEAQAF
RALVQEKIQKRNQRQSGDRRQ

Sequence of entity 2 (B), FASTA

>9S9X_2 WAS/WASL-interacting protein family member 1 (chains B)
SGQDSPCEDEWESRFYFHPISDLPPPEPYVQTTKSYPSKLARNESRSGSNRRE

Primary citation

Structure of the human WASP-EVH1/WIP complex: Molecular basis of the WIP chaperone function. Sasson, I., Baluom, S., Halle-Bikovski, A. et al. To be published.

Other PDB entries of the same protein (UniProt P42768 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2OT0 2.05 Å, Fructose-1,6-bisphosphate aldolase from rabbit muscle in complex with a C-terminal…
2A3Z 2.08 Å, Ternary complex of the WH2 domain of WASP with Actin-DNAse I
1CEE Solution structure of CDC42 in complex with the gtpase binding domain of wasp
1EJ5 Solution structure of the autoinhibited conformation of wasp
1T84 Solution structure of the Wiskott-Aldrich Syndrome Protein (WASP) autoinhibited core…
2K42 Solution Structure of the GTPase Binding Domain of WASP in Complex with EspFU, an EHEC…

Browse structure collections

About this viewer

MolViewer shows 9S9X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.