9T1D: Detyrosinated tubulin alpha-1A chain

Cryo-EM reconstruction of undecorated GDP microtubule. Determined by electron microscopy at 2.9 Å resolution. Released 6 May 2026.

Method: Electron microscopy
Resolution: 2.9 Å
Organism: Sus scrofa
Chains: 2
Atoms: 6,746
Mol. weight: 97.89 kDa
Ligands: GDP, MG, GTP
Released: 6 May 2026

Explore 9T1D in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9T1D contains 50 α-helices and 43 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	1
α-helix	10-28	19
β-strand	35	1	2
α-helix	49-51	3
β-strand	53-55	3	3
β-strand	60	1	2
β-strand	61-63	3	3
β-strand	65-69	5	1
α-helix	72-79	8
α-helix	89-91	3
β-strand	92-94	3	1
α-helix	103-104	2
α-helix	105-109	5
α-helix	111-127	17
β-strand	132-138	7	1
β-strand	140	1	4
α-helix	144	1
α-helix	145-149	5
α-helix	150-160	11
β-strand	165-168	4	1
β-strand	171-172	2	4
α-helix	183-194	12
β-strand	200-201	2	1
β-strand	203	1	5
β-strand	204-205	2	4
α-helix	206-215	10
α-helix	224-238	15
β-strand	246	1	6
α-helix	252-259	8
α-helix	268	1
β-strand	269	1	5
α-helix	270	1
β-strand	271	1	7
β-strand	272-273	2	5
β-strand	277	1	8
α-helix	288-295	8
α-helix	298-300	3
β-strand	301	1	7
α-helix	307-309	3
β-strand	312-321	10	5
α-helix	325-337	13
β-strand	351-355	5	5
β-strand	356	1	6
α-helix	359-361	3
β-strand	368	1	8
α-helix	369-370	2
β-strand	373-381	9	5
α-helix	384-400	17
α-helix	405-411	7
α-helix	416-436	21

Chain B: 25 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	3-9	7	9
α-helix	10-28	19
β-strand	30	1	10
β-strand	35	1	11
β-strand	36	1	10
α-helix	42-45	4
α-helix	47-49	3
β-strand	51-54	4	11
β-strand	58-61	4	11
β-strand	63-67	5	9
α-helix	70-77	8
α-helix	82-84	3
α-helix	87-89	3
β-strand	90-92	3	9
α-helix	101-102	2
α-helix	103-107	5
α-helix	108-125	18
β-strand	130-138	9	9
α-helix	143-158	16
β-strand	163-170	8	9
α-helix	171-172	2
α-helix	181-195	15
β-strand	198-203	6	9
α-helix	204-213	10
α-helix	222-237	16
α-helix	238-240	3
β-strand	246	1	12
α-helix	250-257	8
β-strand	265-266	2	9
β-strand	267-270	4	12
α-helix	286-293	8
α-helix	305-307	3
β-strand	310-318	9	12
α-helix	325-336	12
α-helix	338-340	3
β-strand	341	1	12
β-strand	349-354	6	12
α-helix	357-358	2
β-strand	364-371	8	12
α-helix	372-374	3
α-helix	375-390	16
α-helix	395-399	5
α-helix	406-427	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Detyrosinated tubulin alpha-1A chain	A	protein	439	Sus scrofa	P02550 (AlphaFold model)
Tubulin beta chain	B	protein	429	Sus scrofa	P02554 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9T1D_1 Detyrosinated tubulin alpha-1A chain (chains A)
MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDLVLD
RIRKLADQCTGLQGFSVFHSFGGGTGSGFTSLLMERLSVDYGKKSKLEFSIYPAPQVSTA
VVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLIGQIVSSITA
SLRFDGALNVDLTEFQTNLVPYPRAHFPLATYAPVISAEKAYHEQLSVAEITNACFEPAN
QMVKCDPRHGKYMACCLLYRGDVVPKDVNAAIATIKTKRTIQFVDWCPTGFKVGINYEPP
TVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYVGEGMEEGEFSE
AREDMAALEKDYEEVGVDS

Sequence of entity 2 (B), FASTA

>9T1D_2 Tubulin beta chain (chains B)
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYV
PRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVVPSPKVSDTVV
EPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDAKNMM
AACDPRHGRYLTVAAVFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDAT

Ligands and cofactors

ID	Name	Formula	Copies
GDP	Guanosine-5'-diphosphate	C10 H15 N5 O11 P2	1
MG	Magnesium ion	Mg	1
GTP	Guanosine-5'-triphosphate	C10 H16 N5 O14 P3	1

Primary citation

A cryo-EM processing pipeline for microtubules using CryoSPARC. Zhang, D., Munoz-Hernandez, H., Filipcik, P. et al. Acta Crystallogr D Struct Biol (2026) 82:411-420. DOI 10.1107/S2059798326003062 · PubMed

Other PDB entries of the same protein (UniProt P02550 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7X4N 2.88 Å, Crystal Structure of C. elegans kinesin-4 KLP-12 complexed with tubulin and DARPin
6MZG 3.21 Å, Structural Basis of Tubulin Recruitment and Assembly by Microtubule Polymerases with…
7U0F 3.53 Å, HIV-1 Rev in complex with tubulin
8QAU 3.54 Å, Outer kinetochore Ndc80-Dam1 alpha/beta-tubulin complex
8X9P 3.54 Å, HURP (428-534)-alpha-tubulin-beta-tubulin complex
6MZE 3.6 Å, Structural Basis of Tubulin Recruitment and Assembly by Microtubule Polymerases with…
6KIQ 3.62 Å, Complex of yeast cytoplasmic dynein MTBD-High and MT with DTT
1TUB 3.7 Å, Tubulin alpha-beta dimer, electron diffraction
9EDT 3.7 Å, Tubulin cofactors D,E,G bound to tubulin dimer
9EEB 3.7 Å, Tubulin cofactors D,E,G bound to tubulin dimer
9EDR 3.8 Å, Tubulin Cofactors D,E,G,C and Tubulin complex -- TBCC N Terminus Bound to Tubulin
9EDS 3.8 Å, Tubulin cofactors D,E,G,C bound to tubulin dimer -- TBCC N terminus unbound

Browse structure collections

About this viewer

MolViewer shows 9T1D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.