Crystal structure of beta-TrCP bound by diphosphorylated claspin degron peptide. Determined by X-ray diffraction at 1.35 Å resolution. Released 8 Apr 2026.
Explore 9TDZ in 3D Show helices and sheets RCSB PDB PDBe
9TDZ contains 6 α-helices and 28 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 188-199 | 12 | |
| α-helix | 201-210 | 10 | |
| α-helix | 212-215 | 4 | |
| α-helix | 229-251 | 23 | |
| β-strand | 256-261 | 6 | 1 |
| β-strand | 270-275 | 6 | 2 |
| β-strand | 279-284 | 6 | 2 |
| β-strand | 289-293 | 5 | 2 |
| β-strand | 299-303 | 5 | 2 |
| β-strand | 310-315 | 6 | 3 |
| β-strand | 319-324 | 6 | 3 |
| β-strand | 328-333 | 6 | 3 |
| β-strand | 339-344 | 6 | 3 |
| β-strand | 350-356 | 7 | 4 |
| β-strand | 359-364 | 6 | 4 |
| β-strand | 369-376 | 8 | 4 |
| β-strand | 379-386 | 8 | 4 |
| β-strand | 393-398 | 6 | 5 |
| β-strand | 402-407 | 6 | 5 |
| β-strand | 412-416 | 5 | 5 |
| β-strand | 422-426 | 5 | 5 |
| β-strand | 433-439 | 7 | 6 |
| β-strand | 442-447 | 6 | 6 |
| β-strand | 451-456 | 6 | 6 |
| β-strand | 461-467 | 7 | 6 |
| β-strand | 473-478 | 6 | 7 |
| β-strand | 482-487 | 6 | 7 |
| β-strand | 491-496 | 6 | 7 |
| α-helix | 497-500 | 4 | |
| α-helix | 507-509 | 3 | |
| β-strand | 511-516 | 6 | 7 |
| β-strand | 522-527 | 6 | 1 |
| β-strand | 531-536 | 6 | 1 |
| β-strand | 540-545 | 6 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| F-box/WD repeat-containing protein 1A | A | protein | 365 | Homo sapiens | Q9Y297 (AlphaFold model) |
| Claspin | B | protein | 12 | Homo sapiens | Q9HAW4 (AlphaFold model) |
>9TDZ_1 F-box/WD repeat-containing protein 1A (chains A) GSGMEWKKEIERMVRTDSLWRGLAERRGWGQYLFKNKPPDGNAPPNSFYRALYPKIIQDI ETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRIL TGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTC SKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFV RTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRI VSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILI WDFLN
>9TDZ_2 Claspin (chains B) SPSDSGQGSYET
| ID | Name | Formula | Copies |
|---|---|---|---|
| MG | Magnesium ion | Mg | 1 |
Water and common crystallization additives (EDO) are not listed.
Structural Studies of beta TrCP Reveal Plasticity in Binding Modes of Consensus and Nonconsensus Degrons. Collie, G.W., Mak, H., Acebron-Garcia-de-Eulate, M. et al. ACS Chem Biol (2026) 21:744-750. DOI 10.1021/acschembio.5c01007 · PubMed
Other PDB entries of the same protein (UniProt Q9Y297 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9TDZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.