9U4A: UBE3A T485E tetramer

Structure of UBE3A T485E tetramer. Determined by electron microscopy at 3.3 Å resolution. Released 23 Sept 2026.

Method: Electron microscopy
Resolution: 3.3 Å
Organism: Homo sapiens
Chains: 4
Atoms: 21,648
Mol. weight: 393.66 kDa
Released: 23 Sept 2026

Explore 9U4A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9U4A contains 182 α-helices and 72 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 47 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	107-120	14
α-helix	124-134	11
α-helix	137-142	6
β-strand	145	1	1
α-helix	146-147	2
β-strand	211	1	1
α-helix	213-223	11
α-helix	227-250	24
α-helix	253-256	4
α-helix	261-267	7
α-helix	276-279	4
α-helix	282-290	9
α-helix	295-305	11
α-helix	310-330	21
α-helix	339-341	3
α-helix	346-362	17
β-strand	364	1	2
β-strand	371	1	3
α-helix	404-409	6
β-strand	418	1	2
α-helix	423-425	3
α-helix	429-433	5
α-helix	437-445	9
α-helix	454-456	3
α-helix	458-460	3
α-helix	463-471	9
α-helix	472-474	3
α-helix	481-487	7
α-helix	497-499	3
β-strand	500-504	5	4
α-helix	506-508	3
α-helix	512-523	12
α-helix	525-529	5
α-helix	531	1
β-strand	532-536	5	4
α-helix	545-547	3
α-helix	548-560	13
β-strand	567-570	4	5
β-strand	575-578	4	5
α-helix	587-601	15
α-helix	612-618	7
β-strand	621	1	3
α-helix	625-627	3
α-helix	628-631	4
α-helix	633-643	11
α-helix	649-651	3
β-strand	656	1	6
β-strand	659-662	4	7
β-strand	668-671	4	7
β-strand	681	1	6
α-helix	687-696	10
α-helix	697-701	5
α-helix	704-715	12
α-helix	723-726	4
α-helix	729-736	8
β-strand	739	1	8
α-helix	744-750	7
β-strand	752-753	2	9
α-helix	762-770	9
α-helix	776-786	11
β-strand	792	1	8
α-helix	793	1
α-helix	797-799	3
β-strand	803-804	2	9
β-strand	817	1	9
β-strand	823-824	2	9
α-helix	833-837	5

Chain B: 44 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	107-120	14
α-helix	124-134	11
α-helix	137-142	6
α-helix	145-147	3
α-helix	213-222	10
α-helix	227-246	20
α-helix	247-251	5
α-helix	253-256	4
α-helix	258-261	4
α-helix	262-267	6
α-helix	278-280	3
α-helix	282-290	9
α-helix	295-306	12
α-helix	310-330	21
α-helix	343-362	20
β-strand	365	1	10
β-strand	371	1	11
α-helix	372-373	2
α-helix	404-409	6
β-strand	416	1	10
α-helix	423-426	4
α-helix	429-434	6
α-helix	440-446	7
α-helix	454-456	3
α-helix	458-460	3
α-helix	463-474	12
β-strand	499-504	6	12
α-helix	511-522	12
α-helix	525-529	5
β-strand	531-536	6	12
α-helix	546-559	14
β-strand	567-570	4	13
β-strand	575-578	4	13
α-helix	586-601	16
α-helix	612-617	6
β-strand	621	1	11
α-helix	625-627	3
α-helix	628-631	4
α-helix	633-643	11
α-helix	649-652	4
β-strand	658-662	5	14
β-strand	668-672	5	14
α-helix	687-696	10
α-helix	697-701	5
α-helix	704-717	14
α-helix	723-726	4
α-helix	729-736	8
β-strand	739	1	15
α-helix	746-750	5
β-strand	752-754	3	16
α-helix	762-771	10
α-helix	776-786	11
β-strand	792	1	15
α-helix	793	1
α-helix	797-799	3
β-strand	803-806	4	16
α-helix	813-815	3
β-strand	816-818	3	16
β-strand	823-826	4	16
α-helix	832-843	12

Chain C: 47 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	107-120	14
α-helix	124-134	11
α-helix	137-142	6
β-strand	145	1	17
α-helix	146-147	2
β-strand	211	1	17
α-helix	213-223	11
α-helix	227-250	24
α-helix	253-256	4
α-helix	261-267	7
α-helix	276-279	4
α-helix	282-290	9
α-helix	295-305	11
α-helix	310-330	21
α-helix	339-341	3
α-helix	346-362	17
β-strand	364	1	18
β-strand	371	1	19
α-helix	404-409	6
β-strand	418	1	18
α-helix	423-425	3
α-helix	429-433	5
α-helix	437-445	9
α-helix	454-456	3
α-helix	458-460	3
α-helix	463-471	9
α-helix	472-474	3
α-helix	481-487	7
α-helix	497-499	3
β-strand	500-504	5	20
α-helix	506-508	3
α-helix	512-523	12
α-helix	525-529	5
α-helix	531	1
β-strand	532-536	5	20
α-helix	545-547	3
α-helix	548-560	13
β-strand	567-570	4	21
β-strand	575-578	4	21
α-helix	587-601	15
α-helix	612-618	7
β-strand	621	1	19
α-helix	625-627	3
α-helix	628-631	4
α-helix	633-643	11
α-helix	649-651	3
β-strand	656	1	22
β-strand	659-662	4	23
β-strand	668-671	4	23
β-strand	681	1	22
α-helix	687-696	10
α-helix	697-701	5
α-helix	704-715	12
α-helix	723-726	4
α-helix	729-736	8
β-strand	739	1	24
α-helix	744-750	7
β-strand	752-753	2	25
α-helix	762-770	9
α-helix	776-786	11
β-strand	792	1	24
α-helix	793	1
α-helix	797-799	3
β-strand	803-806	4	25
β-strand	817	1	25
β-strand	823-826	4	25
α-helix	833-837	5

Chain D: 44 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	107-120	14
α-helix	124-134	11
α-helix	137-142	6
α-helix	145-147	3
α-helix	213-222	10
α-helix	227-246	20
α-helix	247-251	5
α-helix	253-256	4
α-helix	258-261	4
α-helix	264-267	4
α-helix	278-280	3
α-helix	282-290	9
α-helix	295-305	11
α-helix	310-330	21
α-helix	345-362	18
β-strand	365	1	26
β-strand	371	1	27
α-helix	372-373	2
α-helix	404-409	6
β-strand	416	1	26
α-helix	423-426	4
α-helix	429-434	6
α-helix	440-446	7
α-helix	454-456	3
α-helix	458-460	3
α-helix	463-474	12
β-strand	499-504	6	28
α-helix	511-522	12
α-helix	525-529	5
β-strand	531-536	6	28
α-helix	546-559	14
β-strand	567-570	4	29
β-strand	575-578	4	29
α-helix	586-601	16
α-helix	612-617	6
β-strand	621	1	27
α-helix	625-627	3
α-helix	628-631	4
α-helix	633-643	11
α-helix	649-652	4
β-strand	658-662	5	30
β-strand	668-672	5	30
α-helix	687-696	10
α-helix	697-701	5
α-helix	704-717	14
α-helix	723-726	4
α-helix	729-736	8
β-strand	739	1	31
α-helix	746-750	5
β-strand	752-754	3	32
α-helix	762-771	10
α-helix	776-786	11
β-strand	792	1	31
α-helix	793	1
α-helix	797-799	3
β-strand	803-806	4	32
α-helix	813-815	3
β-strand	816-818	3	32
β-strand	823-826	4	32
α-helix	832-843	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform I of Ubiquitin-protein ligase E3A	A, B, C, D	protein	856	Homo sapiens	Q05086 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>9U4A_1 Isoform I of Ubiquitin-protein ligase E3A (chains A, B, C, D)
GPGSMKRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALELYKIN
AKLCDPHPSKKGASSAYLENSKGAPNNSCSEIKMNKKGARIDFKDVTYLTEEKVYEILEL
CREREDYSPLIRVIGRVFSSAEALVQSFRKVKQHTKEELKSLQAKDEDKDEDEKEKAACS
AAAMEEDSEASSSRIGDSSQGDNNLQKLGPDDVSVDIDAIRRVYTRLLSNEKIETAFLNA
LVYLSPNVECDLTYHNVYSRDPNYLNLFIIVMENRNLHSPEYLEMALPLFCKAMSKLPLA
AQGKLIRLWSKYNADQIRRMMETFQQLITYKVISNEFNSRNLVNDDDAIVAASKCLKMVY
YANVVGGEVDTNHNEEDDEEPIPESSELTLQELLGEERRNKKGPRVDPLETELGVKTLDC
RKPLIPFEEFINEPLNEVLEMDKDYTFFKVETENKFSFMTCPFILNAVTKNLGLYYDNRI
RMYSERRIEVLYSLVQGQQLNPYLRLKVRRDHIIDDALVRLEMIAMENPADLKKQLYVEF
EGEQGVDEGGVSKEFFQLVVEEIFNPDIGMFTYDESTKLFWFNPSSFETEGQFTLIGIVL
GLAIYNNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGNVEDDMMIT
FQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYILNKSVEKQFKAFRRGFHM
VTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEYDGGYTRDSVLIREFWEIVHSFTD
EQKRLFLQFTTGTDRAPVGGLGKLKMIIAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLK
ERLLKAITYAKGFGML

Primary citation

Structure of UBE3A T485E tetramer. Ren, X.K., Xin, J., Liu, J.B. et al. To be published.

Other PDB entries of the same protein (UniProt Q05086 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6TGK 1.3 Å, Domain swapped E6AP C-lobe dimer
6SJV 2.03 Å, Structure of HPV18 E6 oncoprotein in complex with mutant E6AP LxxLL motif
4XR8 2.25 Å, Crystal structure of the HPV16 E6/E6AP/p53 ternary complex at 2.25 A resolution
7QPB 2.34 Å, Catalytic C-lobe of the HECT-type ubiquitin ligase E6AP in complex with a hybrid…
4GIZ 2.55 Å, Crystal structure of full-length human papillomavirus oncoprotein E6 in complex with…
9L3L 2.59 Å, Crystal structure of the C lobe of E6AP in complex with K48-linked diUb
1C4Z 2.6 Å, Structure of an E6AP-UBCH7 complex: insights into the ubiquitination pathway
8JRN 2.6 Å, Structure of E6AP-E6 complex in Att1 state
1D5F 2.8 Å, Structure of E6AP: insights into ubiquitination pathway
6SLM 2.8 Å, Crystal structure of full-length HPV31 E6 oncoprotein in complex with LXXLL peptide of…
8JRO 3.01 Å, Structure of E6AP-E6 complex in Att2 state
7Q41 3.01 Å, Crystal structure of RCC1-Like domain 2 of ubiquitin ligase HERC2 in complex with…

Browse structure collections

About this viewer

MolViewer shows 9U4A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.