9UDC: SLC15A2 with NAD+

Name: PDB 9UDC: Cryo-EM Structure of SLC15A2 with NAD+ (Pose 1)
Published: 2026-04-15
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: membrane protein

Cryo-EM Structure of SLC15A2 with NAD+ (Pose 1). Determined by electron microscopy at 3.38 Å resolution. Released 15 Apr 2026.

Method: Electron microscopy
Resolution: 3.38 Å
Organism: Homo sapiens
Chains: 1
Atoms: 5,250
Mol. weight: 82.52 kDa
Ligands: NAD
Released: 15 Apr 2026

Explore 9UDC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9UDC contains 28 α-helices and 28 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 28 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	42-45	4
α-helix	47-65	19
α-helix	67-69	3
α-helix	70-74	5
α-helix	79-108	30
α-helix	111-131	21
α-helix	139-171	33
α-helix	177-208	32
α-helix	217-237	21
α-helix	244-247	4
α-helix	251-269	19
α-helix	280-284	5
α-helix	290-303	14
α-helix	304-306	3
α-helix	309-316	8
α-helix	323-328	6
β-strand	331	1	1
β-strand	333	1	2
β-strand	338	1	2
α-helix	344-346	3
α-helix	347-353	7
α-helix	356-358	3
α-helix	359-363	5
α-helix	364-369	6
α-helix	372-374	3
α-helix	386-404	19
α-helix	406-407	2
β-strand	413-420	8	3
β-strand	426-431	6	4
β-strand	437-443	7	4
β-strand	448	1	3
β-strand	453-456	4	3
β-strand	461-470	10	4
β-strand	473-482	10	4
β-strand	485-491	7	3
β-strand	492-494	3	5
β-strand	497-499	3	5
β-strand	502-505	4	3
β-strand	516-517	2	6
β-strand	519-521	3	7
β-strand	527-530	4	8
β-strand	536-539	4	8
β-strand	544-545	2	7
β-strand	549-550	2	6
β-strand	554-555	2	9
β-strand	559-563	5	8
β-strand	567-570	4	8
β-strand	574-575	2	9
β-strand	580	1	6
β-strand	581-588	8	7
β-strand	592-599	8	7
β-strand	607	1	1
α-helix	608-611	4
α-helix	612-636	25
α-helix	642-666	25
α-helix	671-694	24

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Solute carrier family 15 member 2	A	protein	729	Homo sapiens	Q16348 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9UDC_1 Solute carrier family 15 member 2 (chains A)
MNPFQKNESKETLFSPVSIEEVPPRPPSPPKKPSPTICGSNYPLSIAFIVVNEFCERFSY
YGMKAVLILYFLYFLHWNEDTSTSIYHAFSSLCYFTPILGAAIADSWLGKFKTIIYLSLV
YVLGHVIKSLGALPILGGQVVHTVLSLIGLSLIALGTGGIKPCVAAFGGDQFEEKHAEER
TRYFSVFYLSINAGSLISTFITPMLRGDVQCFGEDCYALAFGVPGLLMVIALVVFAMGSK
IYNKPPPEGNIVAQVFKCIWFAISNRFKNRSGDIPKRQHWLDWAAEKYPKQLIMDVKALT
RVLFLYIPLPMFWALLDQQGSRWTLQAIRMNRNLGFFVLQPDQMQVLNPLLVLIFIPLFD
FVIYRLVSKCGINFSSLRKMAVGMILACLAFAVAAAVEIKINEMAPAQPGPQEVFLQVLN
LADDEVKVTVVGNENNSLLIESIKSFQKTPHYSKLHLKTKSQDFHFHLKYHNLSLYTEHS
VQEKNWYSLVIREDGNSISSMMVKDTESRTTNGMTTVRFVNTLHKDVNISLSTDTSLNVG
EDYGVSAYRTVQRGEYPAVHCRTEDKNFSLNLGLLDFGAAYLFVITNNTNQGLQAWKIED
IPANKMSIAWQLPQYALVTAGEVMFSVTGLEFSYSQAPSSMKSVLQAAWLLTIAVGNIIV
LVVAQFSGLVQWAEFILFSCLLLVICLIFSIMGYYYVPVKTEDMRGPADKHIPHIQGNMI
KLETKKTKL

Ligands and cofactors

ID	Name	Formula	Copies
NAD	Nicotinamide-adenine-dinucleotide	C21 H27 N7 O14 P2	1

Primary citation

CryoEM structure of a transmembrane protein. Ning, Y., Ge, J. To be published.

Other PDB entries of the same protein (UniProt Q16348 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6EZI 1.5 Å, PDZK1 domain 4 in complex with C-terminal peptide of human PepT2.
9VVM 3.38 Å, CryoEM structure of a transmembrane protein
7PMY 3.8 Å, HsPepT2 bound to Ala-Phe in the inward facing partially occluded conformation

Browse structure collections

About this viewer

MolViewer shows 9UDC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.