9UGP: MCL-1

Crystal structure of MCL-1 in complex with HRK BH3. Determined by X-ray diffraction at 1.39 Å resolution. Released 21 May 2025.

Method: X-ray diffraction
Resolution: 1.39 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,556
Mol. weight: 20.49 kDa
Released: 21 May 2025

Explore 9UGP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9UGP contains 9 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	173-191	19
α-helix	204-235	32
α-helix	240-253	14
α-helix	261-280	20
α-helix	284-286	3
α-helix	287-301	15
α-helix	303-308	6
α-helix	312-318	7

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	29-49	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Induced myeloid leukemia cell differentiation protein Mcl-1	A	protein	154	Homo sapiens	Q07820 (AlphaFold model)
Activator of apoptosis harakiri	B	protein	25	Homo sapiens	O00198 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9UGP_1 Induced myeloid leukemia cell differentiation protein Mcl-1 (chains A)
SMEDELYRQSLEIISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAF
QGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIE
PLAESITDVLVRTKRDWLVKQRGWDGFVEFFHVE

Sequence of entity 2 (B), FASTA

>9UGP_2 Activator of apoptosis harakiri (chains B)
SSAAQLTAARLKALGDELHQRTMWR

Primary citation

Structural analysis of apoptotic MCL1-HRK complex. Wang, J., Jiang, L., Wei, H. Biochem Biophys Res Commun (2025) 768:151941-151941. DOI 10.1016/j.bbrc.2025.151941 · PubMed

Other PDB entries of the same protein (UniProt Q07820 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8VJP 1.13 Å, Histidine-covalent stapled alpha-helical peptide (155H1) targeting hMcl-1
9PQ7 1.24 Å, MBP-Mcl1 in complex with ligand 21b
9PQ5 1.28 Å, MBP-Mcl1 in complex with ligand 8
6UDV 1.35 Å, X-ray co-crystal structure of compound 3 bound to human Mcl-1
8G3S 1.4 Å, MBP-Mcl1 in complex with ligand 11
5W89 1.42 Å, Crystal structure of human Mcl-1 in complex with modified Bim BH3 peptide SAH-MS1-18
5C3F 1.43 Å, Crystal structure of Mcl-1 bound to BID-MM
8G3X 1.46 Å, MBP-Mcl1 in complex with ligand 32
8H7B 1.46 Å, The crystal structure of human mcl1 kinase domain in complex with MCL1-M-EBA
8SVY 1.47 Å, MBP-Mcl1 in complex with ligand 10
6OQD 1.48 Å, Crystal structure of Mcl1 with inhibitor 8
5FC4 1.5 Å, Mcl-1 complexed with small molecule inhibitor

Browse structure collections

About this viewer

MolViewer shows 9UGP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.