9UVT: Heavy chain of anti-BRIL SRP2070 fab antibody

Cryo-EM structure of bradykinin B2 receptor (B2R)-BRIL/anti BRIL SRP2070 Fab antibody complex with icatibant. Determined by electron microscopy at 3.29 Å resolution. Released 6 May 2026.

Method: Electron microscopy
Resolution: 3.29 Å
Organisms: Mus musculus, Homo sapiens, Escherichia coli
Chains: 4
Atoms: 4,529
Mol. weight: 113.63 kDa
Released: 6 May 2026

Explore 9UVT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9UVT contains 22 α-helices and 31 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	61-82	22
α-helix	91-118	28
α-helix	131-158	28
α-helix	174-188	15
α-helix	191-194	4
β-strand	196	1	7
β-strand	201	1	8
β-strand	208	1	8
β-strand	213	1	7
α-helix	218-229	12
α-helix	230-234	5
α-helix	235-269	35
α-helix	274-293	20
α-helix	315-332	18
α-helix	335-349	15
α-helix	353-380	28
α-helix	382-395	14
α-helix	406-419	14
α-helix	422-431	10

Chain H: 5 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	1
β-strand	10-12	3	2
β-strand	19-25	7	1
α-helix	29-31	3
β-strand	34-39	6	2
β-strand	45-52	8	2
β-strand	57-60	4	2
α-helix	62-64	3
β-strand	68-73	6	1
α-helix	74-76	3
β-strand	78-83	6	1
α-helix	88-90	3
β-strand	92-98	7	2
α-helix	99-100	2
β-strand	101	1	3
β-strand	104	1	3
β-strand	108-109	2	2
β-strand	110	1	1
β-strand	113-117	5	2

Chain L: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	4
β-strand	10-13	4	5
β-strand	19-25	7	4
β-strand	33-38	6	5
β-strand	45-49	5	5
β-strand	53-54	2	5
β-strand	63-64	2	4
β-strand	67	1	6
β-strand	70	1	6
β-strand	72-75	4	4
α-helix	80-82	3
β-strand	84-90	7	5
α-helix	96	1
β-strand	97-98	2	5
β-strand	102-106	5	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Heavy chain of anti-BRIL SRP2070 fab antibody	H	protein	290	Mus musculus
Light chain of anti-BRIL SRP2070 fab antibody	L	protein	235	Mus musculus
B2 bradykinin receptor,Soluble cytochrome b562	A	protein	487	Homo sapiens, Escherichia coli	P0ABE7 (AlphaFold model), P30411 (AlphaFold model)
icatibant	B	protein	10	synthetic construct

Sequence of entity 1 (H), FASTA

>9UVT_1 Heavy chain of anti-BRIL SRP2070 fab antibody (chains H)
MEAPAQLLFLLLLWLPSSRAMQIQLQQSGPELVKPGASVKISCKASGYTFTDFYINWMKQ
RPGQGLEWIGWIFPGSGNTHYNEKFKGKATLIVDTSSSTAFMQLNSLTSEDSAVYFCTRP
VSYYYDFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGDTSGSSVTLGCLVKGYFPEPVTLT
WNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
GCLEVLFQGPGHHHHHHHHSAWSHPQFEKGGGSGGGGSGGSAWSHPQFEK

Sequence of entity 2 (L), FASTA

>9UVT_2 Light chain of anti-BRIL SRP2070 fab antibody (chains L)
MEAPAQLLFLLLLWLPSSRAMDIVLTQSPATLSVTPGDRVSLSCRASQSVSNYLHWYQQK
SHESPRLLIKYASQSISGIPSRFSGSGSGTDFTLSINSVETEDFGMYFCQQSNSWPLTFG
AGTKLELRRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGV
LNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 3 (A), FASTA

>9UVT_3 B2 bradykinin receptor,Soluble cytochrome b562 (chains A)
GPLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQPPFLWVLF
VLATLENIFVLSVFCLHKSSCTVAEIYLGNLAAADLILACGLPFWAITISNNFDWLFGET
LCRVVNAIISMNLYSSICFLMLVSIDRYLALVKTMSMGRMRGVRWAKLYSLVIWGCTLLL
SSPMLVFRTMKEYSDEGHNVTACVISYPSLIWEVFTNMLLNVVGFLLPLSVITFCTMQIM
QVLADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPKLEDKSPDSPE
MKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLKEIQTERRATV
LVLVVLLLFIICWLPFQISTFLDTLHRLGILSSCQDERIIDVITQIASFMAYSNSCLNPL
VYVIVGKRFRKKSWEVYQGVCQKGGCRSEPIQMENSMGTLRTSISVERQIHKLQDWAGSR
QLEVLFQ

Sequence of entity 4 (B), FASTA

>9UVT_4 icatibant (chains B)
RRPPGASXXR

Primary citation

A Rapid and Universal Pipeline for High-Resolution GPCR Structure Determination through <em>In Silico</em> Construct Optimization and de novo Protein Design. Kojima, A., Kawakami, K., Kobayashi, N. et al. bioRxiv (2026). DOI 10.64898/2026.04.02.716066

Other PDB entries of the same protein (UniProt P0ABE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6DYF 1.1 Å, Cu(II)-bound structure of the engineered cyt cb562 variant, CH3Y
5YO6 1.2 Å, Crystal Structure of B562RIL with engineered disulfide bond T9C-A36C
4JEA 1.22 Å, Crystal structure of an engineered Zn-RIDC1 construct with four interfacial disulfide…
7LSJ 1.26 Å, Cu-bound crystal structure of the engineered cyt cb562 variant, DiCyt2 - H63A,…
7MK4 1.27 Å, Co-bound crystal structure of the engineered cyt cb562 variant, DiCyt2
6DYC 1.33 Å, Co(II)-bound structure of the engineered cyt cb562 variant, CH3
5YO4 1.37 Å, Crystal Structure of B562RIL with engineered disulfide bond K27C-A79C
256B 1.4 Å, Improvement of the 2.5 Å resolution model of cytochrome B562 by redetermining the…
6OT4 1.4 Å, Bimetallic dodecameric cage design 2 (BMC2) from cytochrome cb562
7LRV 1.4 Å, Ni-bound crystal structure of the engineered cyt cb562 variant, DiCyt2, crystallized in…
9PQ4 1.48 Å, Bi-bound structure of the H77C variant of TriCyt2
6DYG 1.49 Å, Fe(II)-bound structure of the engineered cyt cb562 variant, CH3Y

Browse structure collections

About this viewer

MolViewer shows 9UVT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.