9UVW: Vasopressin V2 receptor,Soluble cytochrome b562

Cryo-EM structure of Vasopressin receptor 2 (V2R)-BRIL/anti BRIL SRP2070 Fab antibody complex with tolvaptan, focused on receptor. Determined by electron microscopy at 2.89 Å resolution. Released 6 May 2026.

Method: Electron microscopy
Resolution: 2.89 Å
Organisms: Homo sapiens, Escherichia coli
Chains: 1
Atoms: 2,113
Mol. weight: 54.04 kDa
Ligands: A1IT8
Released: 6 May 2026

Explore 9UVW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9UVW contains 13 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	39-67	29
α-helix	73-88	16
α-helix	89-93	5
α-helix	94-101	8
α-helix	109-142	34
β-strand	152	1	1
β-strand	157	1	1
α-helix	158-169	12
α-helix	174-177	4
β-strand	178	1	2
β-strand	181	1	3
β-strand	191	1	3
β-strand	194	1	2
α-helix	204-210	7
α-helix	211-215	5
α-helix	216-235	20
α-helix	344-374	31
α-helix	385-404	20
α-helix	408-418	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vasopressin V2 receptor,Soluble cytochrome b562	A	protein	486	Homo sapiens, Escherichia coli	P0ABE7 (AlphaFold model), P30518 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9UVW_1 Vasopressin V2 receptor,Soluble cytochrome b562 (chains A)
MKTIIALSYIFCLVFADYKDDDDAENLYFQGMLMASTTSAVPGHPSLPSLPSNSSQERPL
DTRDPLLARAELALLSIVFVAVALSNGLVLAALARRGRRGHWAPIHVFIGHLCLADLAVA
LFQVLPQLAWKATDRFRGPDALCRAVKYLQMVGMYASSYMILAMTLDRHRAICRPMLAYR
HGSGAHWNRPVLVAWAFSLLLSLPQLFIFAQRNVEGGSGVTDCWACFAEPWGRRTYVTWI
ALMVFVAPTLGIAACQVLIFREIHASLADLEDNWETLNDNLKVIEKADNAAQVKDALTKM
RAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQ
LKTTRNAYIQKYLAVAKTVRMTLVIVVVYVLCWAPFFLVQLWAAWDPEAPLEGAPFVLLM
LLASLNSCTNPWIYASFSSSVSSELRSLLCCARGRTPPSLGPQDESCTTASSSLAKDTSS
LEVLFQ

Ligands and cofactors

ID	Name	Formula	Copies
A1IT8	(R)-Tolvaptan	C26 H25 Cl N2 O3	1

Primary citation

A Rapid and Universal Pipeline for High-Resolution GPCR Structure Determination through <em>In Silico</em> Construct Optimization and de novo Protein Design. Kojima, A., Kawakami, K., Kobayashi, N. et al. bioRxiv (2026). DOI 10.64898/2026.04.02.716066

Other PDB entries of the same protein (UniProt P0ABE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6DYF 1.1 Å, Cu(II)-bound structure of the engineered cyt cb562 variant, CH3Y
5YO6 1.2 Å, Crystal Structure of B562RIL with engineered disulfide bond T9C-A36C
4JEA 1.22 Å, Crystal structure of an engineered Zn-RIDC1 construct with four interfacial disulfide…
7LSJ 1.26 Å, Cu-bound crystal structure of the engineered cyt cb562 variant, DiCyt2 - H63A,…
7MK4 1.27 Å, Co-bound crystal structure of the engineered cyt cb562 variant, DiCyt2
6DYC 1.33 Å, Co(II)-bound structure of the engineered cyt cb562 variant, CH3
5YO4 1.37 Å, Crystal Structure of B562RIL with engineered disulfide bond K27C-A79C
256B 1.4 Å, Improvement of the 2.5 Å resolution model of cytochrome B562 by redetermining the…
6OT4 1.4 Å, Bimetallic dodecameric cage design 2 (BMC2) from cytochrome cb562
7LRV 1.4 Å, Ni-bound crystal structure of the engineered cyt cb562 variant, DiCyt2, crystallized in…
9PQ4 1.48 Å, Bi-bound structure of the H77C variant of TriCyt2
6DYG 1.49 Å, Fe(II)-bound structure of the engineered cyt cb562 variant, CH3Y

Browse structure collections

About this viewer

MolViewer shows 9UVW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.