9UYM: Retinoic acid receptor responder protein 2
Composite map of the G protein-coupled receptor 1 (GPR1) bound to chemerin and beta-arrestin 2. Determined by electron microscopy at 3.5 Å resolution. Released 19 Nov 2025.
- Method
- Electron microscopy
- Resolution
- 3.5 Å
- Organisms
- Homo sapiens, Escherichia phage EcSzw-2
- Chains
- 5
- Atoms
- 7,581
- Mol. weight
- 147.14 kDa
- Ligands
- Y01
- Released
- 19 Nov 2025
Explore 9UYM in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9UYM contains 25 α-helices and 68 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 7 helices, 28 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 9-13 | 5 | 12 |
| α-helix | 15-17 | 3 | |
| β-strand | 19-23 | 5 | 12 |
| β-strand | 27-29 | 3 | 13 |
| β-strand | 30 | 1 | 14 |
| β-strand | 35 | 1 | 14 |
| β-strand | 38-44 | 7 | 12 |
| β-strand | 53-63 | 11 | 15 |
| β-strand | 77-85 | 9 | 15 |
| α-helix | 102-109 | 8 | |
| β-strand | 113-118 | 6 | 12 |
| β-strand | 128-130 | 3 | 15 |
| β-strand | 141-152 | 12 | 15 |
| β-strand | 165-169 | 5 | 15 |
| β-strand | 170-172 | 3 | 13 |
| α-helix | 181-183 | 3 | |
| β-strand | 185-188 | 4 | 16 |
| β-strand | 199-204 | 6 | 16 |
| β-strand | 208-209 | 2 | 17 |
| α-helix | 213-214 | 2 | |
| β-strand | 215-221 | 7 | 16 |
| β-strand | 229 | 1 | 18 |
| β-strand | 232-243 | 12 | 19 |
| β-strand | 247-248 | 2 | 19 |
| β-strand | 252-259 | 8 | 19 |
| β-strand | 263 | 1 | 18 |
| β-strand | 269-275 | 7 | 16 |
| β-strand | 289-291 | 3 | 15 |
| β-strand | 301 | 1 | 15 |
| α-helix | 302-305 | 4 | |
| β-strand | 317-328 | 12 | 19 |
| β-strand | 336-342 | 7 | 19 |
| β-strand | 343-344 | 2 | 17 |
| α-helix | 346-349 | 4 | |
| α-helix | 352-354 | 3 | |
Chain B: 1 helix, 8 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 5-7 | 3 | 3 |
| β-strand | 21-23 | 3 | 3 |
| β-strand | 34-38 | 5 | 4 |
| β-strand | 49-51 | 3 | 4 |
| β-strand | 72 | 1 | 5 |
| β-strand | 77 | 1 | 5 |
| β-strand | 78-79 | 2 | 3 |
| β-strand | 93-97 | 5 | 4 |
| α-helix | 103-104 | 2 | |
Chain C: 2 helices, 24 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 6-7 | 2 | 6 |
| β-strand | 11 | 1 | 7 |
| β-strand | 21-25 | 5 | 6 |
| β-strand | 34-39 | 6 | 8 |
| β-strand | 46-50 | 5 | 8 |
| β-strand | 54-55 | 2 | 8 |
| β-strand | 64-67 | 4 | 6 |
| β-strand | 71-75 | 5 | 6 |
| α-helix | 81-83 | 3 | |
| β-strand | 86-91 | 6 | 8 |
| β-strand | 99 | 1 | 8 |
| β-strand | 104 | 1 | 7 |
| β-strand | 127-131 | 5 | 9 |
| β-strand | 134-135 | 2 | 10 |
| β-strand | 144-149 | 6 | 9 |
| β-strand | 156-163 | 8 | 11 |
| β-strand | 169-176 | 8 | 11 |
| β-strand | 181-184 | 4 | 11 |
| β-strand | 189 | 1 | 9 |
| β-strand | 192-196 | 5 | 9 |
| β-strand | 202-207 | 6 | 9 |
| α-helix | 212-214 | 3 | |
| β-strand | 217-224 | 8 | 11 |
| β-strand | 233-234 | 2 | 11 |
| β-strand | 238 | 1 | 11 |
| β-strand | 240-241 | 2 | 10 |
Chain L: 2 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 25-39 | 15 | |
| β-strand | 52 | 1 | 1 |
| β-strand | 68-70 | 3 | 1 |
| β-strand | 98-100 | 3 | 1 |
| β-strand | 101-102 | 2 | 2 |
| β-strand | 113-114 | 2 | 2 |
| α-helix | 135-140 | 6 | |
Chain R: 13 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 36-61 | 26 | |
| α-helix | 62-66 | 5 | |
| α-helix | 71-88 | 18 | |
| α-helix | 90-97 | 8 | |
| α-helix | 110-140 | 31 | |
| α-helix | 151-166 | 16 | |
| α-helix | 170-172 | 3 | |
| β-strand | 177-180 | 4 | 20 |
| β-strand | 185-188 | 4 | 20 |
| α-helix | 197-211 | 15 | |
| α-helix | 212-216 | 5 | |
| α-helix | 217-234 | 18 | |
| α-helix | 242-274 | 33 | |
| α-helix | 282-304 | 23 | |
| α-helix | 313-317 | 5 | |
| β-strand | 1361-1363 | 3 | 12 |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Retinoic acid receptor responder protein 2 | L | protein | 153 | Homo sapiens | Q99969 (AlphaFold model) |
| Nanobody 32 | B | protein | 120 | Escherichia phage EcSzw-2 | |
| Single-chain fragment variable 30 (scFv30) | C | protein | 245 | Homo sapiens | |
| Beta-arrestin-2,Beta-arrestin-1 | A | protein | 369 | Homo sapiens | P32121 (AlphaFold model), P49407 (AlphaFold model) |
| Chemerin-like receptor 2,Vasopressin V2 receptor | R | protein | 414 | Homo sapiens | P30518 (AlphaFold model), P46091 |
Sequence of entity 1 (L), FASTA
>9UYM_1 Retinoic acid receptor responder protein 2 (chains L)
MKTIIALSYIFCLVFAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGI
FVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVL
REAEEHQETQCLRVQRAGEDPHSFYFPGQFAFS
Sequence of entity 2 (B), FASTA
>9UYM_2 Nanobody 32 (chains B)
QVQLQESGGGLVQAGGSLRLSCVVSGFFFDTVTMAWYRRAPGKHRELVASATAGGTTTYA
DSVKDRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNTFVRSLSWGQGTQVTVSSHHHHHH
Sequence of entity 3 (C), FASTA
>9UYM_3 Single-chain fragment variable 30 (scFv30) (chains C)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKGTTAASGSSGGS
SSGAEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYG
YTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLV
TVSSA
Sequence of entity 4 (A), FASTA
>9UYM_4 Beta-arrestin-2,Beta-arrestin-1 (chains A)
MGEKPGTRVFKKSSPNGKLTVYLGKRDFVDHLDKVDPVDGVVLVDPDYLKDRKVFVTLTV
AFRYGREDLDVLGLSFRKDLFIATYQAFPPVPNPPRPPTRLQDRLLRKLGQHAHPFFFTI
PQNLPSSVTLQPGPEDTGKALGVDFEIRAFVAKSLEEKSHKRNSVRLVIRKVQFAPEKPG
PQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPLNVNVHVTNNSTKTVKKIKVSVRQYA
DIVLFSTAQYKVPVAQLEQDDQVSPSSTFSKVYTITPLLSDNREKRGLALDGKLKHEDTN
LASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPKEEPPHREVPE
NETPVDTNL
Sequence of entity 5 (R), FASTA
>9UYM_5 Chemerin-like receptor 2,Vasopressin V2 receptor (chains R)
MKTIIALSYIFCLVFAGSWSHPQFEKGSGAGASAGSWSHPQFEKGSDYKDDDDKEFLEVL
FQGPEDLEETLFEEFENYSYDLDYYSLESDLEEKVQLGVVHWVSLVLYCLAFVLGIPGNA
IVIWFTGFKWKKTVTTLWFLNLAIADFIFLLFLPLYISYVAMNFHWPFGIWLCKANSFTA
QLNMFASVFFLTVISLDHYIHLIHPVLSHRHRTLKNSLIVIIFIWLLASLIGGPALYFRD
TVEFNNHTLCYNNFQKHDPDLTLIRHHVLTWVKFIIGYLFPLLTMSICYLCLIFKVKKRS
ILISSRHFWTILVVVVAFVVCWTPYHLFSIWELTIHHNSYSHHVMQAGIPLSTGLAFLNS
CLNPILYVLISKKFQARFRSSVAEIARGRTPPSLGPQDESCTTASSSLAKDTSS
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| Y01 | Cholesterol hemisuccinate | C31 H50 O4 | 1 |
Primary citation
Noncanonical agonist-dependent and -independent arrestin recruitment of GPR1. Cai, H., Lin, X., Zhao, L. et al. Science (2025) 390:eadt8794-eadt8794. DOI 10.1126/science.adt8794 · PubMed
Other PDB entries of the same protein (UniProt Q99969 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 7YKD 2.81 Å, Cryo-EM structure of the human chemerin receptor 1 complex with the C-terminal…
- 8JJP 2.9 Å, G protein-coupled receptor 1
- 8SG1 2.94 Å, Cryo-EM structure of CMKLR1 signaling complex
- 8ZJG 3.18 Å, Cryo-EM structure of human CMKLR1-Gi complex bound to chemerin
- 9UYI 3.2 Å, Cryo-EM structure of the G protein-coupled receptor 1 (GPR1) bound to chemerin and…
- 8XGM 3.29 Å, Cryo-EM structure of human GPR1 bound to chemerin
- 9UYH 3.3 Å, Cryo-EM structure of the G protein-coupled receptor 1 (GPR1) bound to chemerin and…
- 9UYJ 3.3 Å, Cryo-EM structure of the G protein-coupled receptor 1 (GPR1) bound to chemerin and…
- 9UYL 3.3 Å, Cryo-EM structure of the G protein-coupled receptor 1 (GPR1) bound to chemerin and…
- 9L3W 3.5 Å, Cryo-EM structure of the chemokine-like receptor 1 in complex with chemerin and Gi1
- 9L3Y 3.6 Å, Cryo-EM structure of the G-protein coupled receptor 1 (GPR1) in complex with chemerin…
Browse structure collections
About this viewer
MolViewer shows 9UYM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.