9UYJ: G protein-coupled receptor 1

Cryo-EM structure of the G protein-coupled receptor 1 (GPR1) bound to chemerin and beta-arrestin 1 (Conformation 3). Determined by electron microscopy at 3.3 Å resolution. Released 19 Nov 2025.

Method: Electron microscopy
Resolution: 3.3 Å
Organisms: Homo sapiens, Escherichia phage EcSzw-2
Chains: 5
Atoms: 7,346
Mol. weight: 145.28 kDa
Released: 19 Nov 2025

Explore 9UYJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9UYJ contains 22 α-helices and 78 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 36 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	1
β-strand	19-22	4	1
β-strand	27-28	2	2
β-strand	29	1	3
β-strand	34	1	3
β-strand	37	1	4
β-strand	40-42	3	1
β-strand	52-60	9	5
β-strand	78-85	8	5
α-helix	96-98	3
α-helix	99-108	10
β-strand	112-114	3	1
β-strand	117	1	4
α-helix	123-125	3
β-strand	127-129	3	6
β-strand	140-142	3	6
β-strand	143-151	9	5
β-strand	166-168	3	5
β-strand	170-171	2	2
α-helix	178-182	5
β-strand	183-186	4	7
β-strand	198-202	5	7
β-strand	203	1	8
β-strand	207-209	3	9
β-strand	214-217	4	8
β-strand	220-222	3	7
β-strand	231-239	9	10
β-strand	242	1	11
β-strand	246	1	11
β-strand	249	1	10
β-strand	252-258	7	10
β-strand	266-268	3	7
β-strand	271-274	4	8
β-strand	288-290	3	6
β-strand	300	1	6
α-helix	301-305	5
β-strand	319-327	9	10
β-strand	343	1	10
β-strand	346-349	4	10
β-strand	350-352	3	9
α-helix	354-356	3
β-strand	367	1	12

Chain B: 1 helix, 10 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	13
β-strand	11	1	14
β-strand	20-23	4	13
β-strand	34-39	6	15
β-strand	45-47	3	15
β-strand	67-72	6	13
β-strand	77-82	6	13
β-strand	91-97	7	15
α-helix	105-107	3
β-strand	108-110	3	15
β-strand	111	1	14

Chain C: 3 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	17
β-strand	11-12	2	18
β-strand	20-23	4	19
β-strand	24-26	3	17
β-strand	34-39	6	18
β-strand	45-49	5	18
β-strand	55	1	18
α-helix	56	1
β-strand	57	1	20
β-strand	59	1	20
β-strand	63-66	4	19
β-strand	73-76	4	19
α-helix	81-83	3
β-strand	86-91	6	18
β-strand	94	1	12
β-strand	98	1	21
β-strand	99	1	18
β-strand	103-105	3	18
β-strand	128-131	4	22
β-strand	135	1	23
β-strand	141-148	8	22
β-strand	156-163	8	21
β-strand	169-176	8	21
β-strand	181-184	4	21
β-strand	192-197	6	22
β-strand	202-208	7	22
α-helix	212-214	3
β-strand	216	1	24
β-strand	217-224	8	21
β-strand	231-233	3	21
β-strand	240	1	24
β-strand	241	1	23

Chain R: 12 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	37-63	27
α-helix	71-88	18
α-helix	90-98	9
α-helix	109-139	31
α-helix	151-174	24
β-strand	181	1	16
β-strand	184	1	16
α-helix	202-211	10
α-helix	212-216	5
α-helix	218-236	19
α-helix	248-273	26
α-helix	286-297	12
α-helix	300-303	4
α-helix	1358-1360	3
β-strand	1361-1363	3	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-arrestin-1	A	protein	376	Homo sapiens	P49407 (AlphaFold model)
Nanobody 32	B	protein	120	Escherichia phage EcSzw-2
Chemerin-like receptor 2,Vasopressin V2 receptor	R	protein	396	Homo sapiens	P30518 (AlphaFold model), P46091 (AlphaFold model)
Retinoic acid receptor responder protein 2	L	protein	153	Homo sapiens	Q99969 (AlphaFold model)
Single-chain fragment variable 30 (scFv30)	C	protein	245	Homo sapiens

Sequence of entity 1 (A), FASTA

>9UYJ_1 Beta-arrestin-1 (chains A)
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTAA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPSSVTLQPGPEDTGKAIGVDYEVKAFVAENLEEKIHKRNSVRLVIEKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
IVLFNTAQYKVPVAMEEADDTVAPSSTFSKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPENETPVDTNL

Sequence of entity 2 (B), FASTA

>9UYJ_2 Nanobody 32 (chains B)
QVQLQESGGGLVQAGGSLRLSCVVSGFFFDTVTMAWYRRAPGKHRELVASATAGGTTTYA
DSVKDRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNTFVRSLSWGQGTQVTVSSHHHHHH

Sequence of entity 3 (R), FASTA

>9UYJ_3 Chemerin-like receptor 2,Vasopressin V2 receptor (chains R)
WSHPQFEKGSGAGASAGSWSHPQFEKGSDYKDDDDKEFLEVLFQGPEDLEETLFEEFENY
SYDLDYYSLESDLEEKVQLGVVHWVSLVLYCLAFVLGIPGNAIVIWFTGFKWKKTVTTLW
FLNLAIADFIFLLFLPLYISYVAMNFHWPFGIWLCKANSFTAQLNMFASVFFLTVISLDH
YIHLIHPVLSHRHRTLKNSLIVIIFIWLLASLIGGPALYFRDTVEFNNHTLCYNNFQKHD
PDLTLIRHHVLTWVKFIIGYLFPLLTMSICYLCLIFKVKKRSILISSRHFWTILVVVVAF
VVCWTPYHLFSIWELTIHHNSYSHHVMQAGIPLSTGLAFLNSCLNPILYVLISKKFQARF
RSSVAEIARGRTPPSLGPQDESCTTASSSLAKDTSS

Sequence of entity 4 (L), FASTA

>9UYJ_4 Retinoic acid receptor responder protein 2 (chains L)
MKTIIALSYIFCLVFAELTEAQRRGLQVALEEFHKHPPVQWAFQETSVESAVDTPFPAGI
FVRLEFKLQQTSCRKRDWKKPECKVRPNGRKRKCLACIKLGSEDKVLGRLVHCPIETQVL
REAEEHQETQCLRVQRAGEDPHSFYFPGQFAFS

Sequence of entity 5 (C), FASTA

>9UYJ_5 Single-chain fragment variable 30 (scFv30) (chains C)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKGTTAASGSSGGS
SSGAEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYG
YTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLV
TVSSA

Primary citation

Noncanonical agonist-dependent and -independent arrestin recruitment of GPR1. Cai, H., Lin, X., Zhao, L. et al. Science (2025) 390:eadt8794-eadt8794. DOI 10.1126/science.adt8794 · PubMed

Other PDB entries of the same protein (UniProt P49407 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8AS4 2.3 Å, Crystal structure of human beta-arrestin-1
9ZZO 2.6 Å, MP1104-bound Kappa Opioid Receptor in complex with beta-arrestin1
8ZYT 2.65 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
8ZYU 2.65 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
2IV8 2.8 Å, beta appendage in complex with b-arrestin peptide
8ZYY 2.83 Å, Cryo-EM structure of neurotensin receptor 1 in complex with beta-arrestin1 and SBI-553…
9UYN 2.9 Å, Cryo-EM structure of the G protein-coupled receptor 1 (GPR1) bound to beta-arrestin 1 in…
27EM 3.0 Å, Cryo_EM structure of PACAP27_PAC1R_Beta_arrestin 1 complex
9LXR 3.07 Å, A Cryo-EM structure of LA-PTH-PTH1R-Beta-arrestin1 complex (state 1 conformation)
9LY2 3.1 Å, A Cryo-EM structure of LA-PTH-PTH1R-V2RT-Beta-arrestin1 complex (state 1 conformation)
9MBA 3.14 Å, Cryo-EM structure of complex of transducer-bound GPCR
25GN 3.2 Å, receptor-arrestin

Browse structure collections

About this viewer

MolViewer shows 9UYJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.