9UYN: G protein-coupled receptor 1

Cryo-EM structure of the G protein-coupled receptor 1 (GPR1) bound to beta-arrestin 1 in ligand-free state. Determined by electron microscopy at 2.9 Å resolution. Released 19 Nov 2025.

Method: Electron microscopy
Resolution: 2.9 Å
Organisms: Homo sapiens, Escherichia phage EcSzw-2
Chains: 4
Atoms: 7,503
Mol. weight: 129.79 kDa
Ligands: PAM
Released: 19 Nov 2025

Explore 9UYN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9UYN contains 22 α-helices and 67 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	7-12	6	2
β-strand	18-22	5	2
β-strand	26-28	3	3
β-strand	29-30	2	4
β-strand	33-34	2	4
α-helix	35-36	2
β-strand	37-43	7	2
β-strand	52-62	11	5
β-strand	68	1	6
β-strand	73	1	6
β-strand	78-85	8	5
α-helix	99-108	10
β-strand	112-117	6	2
β-strand	127-129	3	5
α-helix	138-140	3
β-strand	141-151	11	5
β-strand	163-168	6	5
β-strand	169-171	3	3
α-helix	180-182	3
β-strand	183-186	4	7
β-strand	198-203	6	7
β-strand	207-209	3	8
β-strand	214-217	4	7
β-strand	220-222	3	7
β-strand	228-242	15	9
β-strand	246-258	13	9
β-strand	266-268	3	7
β-strand	271-274	4	7
β-strand	288-290	3	5
β-strand	300	1	5
α-helix	301-303	3
β-strand	317-329	13	9
β-strand	343-349	7	9
β-strand	350-352	3	8
α-helix	353-356	4
β-strand	367	1	10

Chain B: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	11
β-strand	10	1	12
β-strand	18-25	8	11
β-strand	34-39	6	12
β-strand	45-51	7	12
β-strand	57-59	3	12
α-helix	61-63	3
β-strand	67-72	6	11
β-strand	77-82	6	11
β-strand	91-97	7	12
α-helix	103-104	2
β-strand	108-110	3	12

Chain C: 2 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	13
β-strand	11-12	2	14
β-strand	20-23	4	15
β-strand	24-26	3	13
β-strand	34-39	6	14
β-strand	46-49	4	14
β-strand	55	1	14
α-helix	56	1
β-strand	63-66	4	15
β-strand	73-76	4	15
α-helix	81-83	3
β-strand	86-91	6	14
β-strand	94	1	10
β-strand	99	1	14
β-strand	103-105	3	14
β-strand	128-131	4	16
β-strand	142-148	7	16
β-strand	156-163	8	17
β-strand	169-176	8	17
β-strand	181-184	4	17
β-strand	192-197	6	16
β-strand	202-207	6	16
β-strand	216	1	18
β-strand	217-224	8	17
β-strand	231-233	3	17
β-strand	240	1	18

Chain R: 12 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	37-61	25
α-helix	62-66	5
α-helix	74-98	25
α-helix	107-139	33
α-helix	142-145	4
α-helix	151-175	25
β-strand	176-181	6	1
β-strand	184-189	6	1
α-helix	202-211	10
α-helix	212-216	5
α-helix	217-229	13
α-helix	245-273	29
α-helix	281-306	26
α-helix	309-316	8
β-strand	1361-1364	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Chemerin-like receptor 2,Vasopressin V2 receptor	R	protein	414	Homo sapiens	P30518 (AlphaFold model), P46091 (AlphaFold model)
Beta-arrestin-1	A	protein	376	Homo sapiens	P49407 (AlphaFold model)
Nanobody 32	B	protein	120	Escherichia phage EcSzw-2
Single-chain fragment variable 30 (scFv30)	C	protein	245	Homo sapiens

Sequence of entity 1 (R), FASTA

>9UYN_1 Chemerin-like receptor 2,Vasopressin V2 receptor (chains R)
MKTIIALSYIFCLVFAGSWSHPQFEKGSGAGASAGSWSHPQFEKGSDYKDDDDKEFLEVL
FQGPEDLEETLFEEFENYSYDLDYYSLESDLEEKVQLGVVHWVSLVLYCLAFVLGIPGNA
IVIWFTGFKWKKTVTTLWFLNLAIADFIFLLFLPLYISYVAMNFHWPFGIWLCKANSFTA
QLNMFASVFFLTVISLDHYIHLIHPCLSHRHRTLKNSLIVIIFIWLLASLIGGPALYFRD
TVEFNNHTLCYNNFQKHDPDLTLIRHHVLTWVKFIIGYLFPLLTMSICYLCLIFKVKKRS
ILISSRHFWTILVVVVAFVVCWTPYHLFSIWELTIHHNSYSHHVMQAGIPLSTGLAFLNS
CLNPILYVLISKKFQARFRSSVAEIARGRTPPSLGPQDESCTTASSSLAKDTSS

Sequence of entity 2 (A), FASTA

>9UYN_2 Beta-arrestin-1 (chains A)
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYVTLTAA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPSSVTLQPGPEDTGKAIGVDYEVKAFVAENLEEKIHKRNSVRLVIEKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
IVLFNTAQCKVPVAMEEADDTVAPSSTFSKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPENETPVDTNL

Sequence of entity 3 (B), FASTA

>9UYN_3 Nanobody 32 (chains B)
QVQLQESGGGLVQAGGSLRLSCVVSGFFFDTVTMAWYRRAPGKHRELVASATAGGTTTYA
DSVKDRFTISRDNAKNTVYLQMNSLKPEDTAVYYCNTFVRSLSWGQGTQVTVSSHHHHHH

Sequence of entity 4 (C), FASTA

>9UYN_4 Single-chain fragment variable 30 (scFv30) (chains C)
SDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGVP
SRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKGTTAASGSSGGS
SSGAEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYG
YTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLV
TVSSA

Ligands and cofactors

ID	Name	Formula	Copies
PAM	Palmitoleic acid	C16 H30 O2	1

Primary citation

Noncanonical agonist-dependent and -independent arrestin recruitment of GPR1. Cai, H., Lin, X., Zhao, L. et al. Science (2025) 390:eadt8794-eadt8794. DOI 10.1126/science.adt8794 · PubMed

Other PDB entries of the same protein (UniProt P30518 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7DFC 2.49 Å, Crystal of Arrestin2-V2Rpp-3-Fab30 complex
9HAP 2.5 Å, Cryo-EM structure of inactive human arginine-vasopressin (AVP) V2 receptor (V2R) with…
9HB3 2.5 Å, cryo-EM structure of inactive human arginine-vasopressin (AVP) V2 receptor (V2R) with…
7DFA 2.54 Å, Crystal of Arrestin2-V2Rpp-4-Fab30 complex
4JQI 2.6 Å, Structure of active beta-arrestin1 bound to a G protein-coupled receptor phosphopeptide
7DW9 2.6 Å, Cryo-EM structure of human V2 vasopressin receptor in complex with an Gs protein
9ZZO 2.6 Å, MP1104-bound Kappa Opioid Receptor in complex with beta-arrestin1
22GM 2.7 Å, C5a bound C5aR1 in complex with beta-arrestin1
7KH0 2.8 Å, Cryo-EM structure of the human arginine vasopressin AVP-vasopressin receptor V2R-Gs…
9WSV 2.8 Å, Cryo-EM structure of DAMGO-muOR-arrestin-1-Fab30 complex
9WSW 2.8 Å, Cryo-EM structure of endomorphin-1-muOR-Gz-scFv16 complex
9WSX 2.8 Å, Cryo-EM structure of endomorphin-1-muOR-arrestin2-Fab30 complex

Browse structure collections

About this viewer

MolViewer shows 9UYN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.