9V82: Local refine map of HEP-50768-bound MRGPRX4

Local refine map of HEP-50768-bound MRGPRX4. Determined by electron microscopy at 2.56 Å resolution. Released 6 May 2026.

Method: Electron microscopy
Resolution: 2.56 Å
Organisms: Escherichia coli, Homo sapiens
Chains: 1
Atoms: 1,905
Mol. weight: 53.75 kDa
Ligands: A1L9Y
Released: 6 May 2026

Explore 9V82 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9V82 contains 15 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain R: 15 helices, 0 β-strands

Element	Residues	Length
α-helix	24-50	27
α-helix	51-55	5
α-helix	60-82	23
α-helix	83-85	3
α-helix	92-125	34
α-helix	127-128	2
α-helix	129-133	5
α-helix	138-157	20
α-helix	179-203	25
α-helix	211-224	14
α-helix	225-229	5
α-helix	230-242	13
α-helix	246-249	4
α-helix	251-269	19
α-helix	270-274	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Soluble cytochrome b562,Mas-related G-protein coupled receptor member X4	R	protein	472	Escherichia coli, Homo sapiens	P0ABE7 (AlphaFold model), Q96LA9 (AlphaFold model)

Sequence of entity 1 (R), FASTA

>9V82_1 Soluble cytochrome b562,Mas-related G-protein coupled receptor member X4 (chains R)
DYKDDDDAKLQTMHHHHHHHHHHENLYFQGGTTMADLEDNWETLNDNLKVIEKADNAAQV
KDALTKMRAAALDAQKATPPKLEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKE
AQAAAEQLKTTRNAYIQKYLGSTLEVLFQGPDPTVPVFGTKLTPINGREETPCYNQTLSF
TVLTCIISLVGLTGNAVVLWLLGYRMRRNAVSIYILNLAAADFLFLSFQIIRSPLRLINI
SHLIRKILVSVMTFPYFTGLSMLSAISTERCLSVLWPIWYRCRRPTHLSAVVCVLLWGLS
LLFSMLEWRFCDFLFSGADSSWCETSDFIPVAWLIFLCVVLCVSSLVLLVRILCGSRKMP
LTRLYVTILLTVLVFLLCGLPFGILGALIYRMHLNLEVLYCHVYLVCMSLSSLNSSANPI
IYFFVGSFRQRQNRQNLKLVLQRALQDKPEVDKGEGQLPEESLELSGSRLGP

Ligands and cofactors

ID	Name	Formula	Copies
A1L9Y	5-[2-fluoranyl-3-[(2S)-5-(trifluoromethyl)-2,3-dihydro-1-benzofuran-2-yl]phenyl…	C16 H10 F4 N4 O	1

Primary citation

Development of a clinically viable MRGPRX4 inverse agonist for cholestatic itch treatment. Yang, J., Shen, R., Wang, C. et al. Nat Chem Biol (2026). DOI 10.1038/s41589-026-02195-0 · PubMed

Other PDB entries of the same protein (UniProt P0ABE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6DYF 1.1 Å, Cu(II)-bound structure of the engineered cyt cb562 variant, CH3Y
5YO6 1.2 Å, Crystal Structure of B562RIL with engineered disulfide bond T9C-A36C
4JEA 1.22 Å, Crystal structure of an engineered Zn-RIDC1 construct with four interfacial disulfide…
7LSJ 1.26 Å, Cu-bound crystal structure of the engineered cyt cb562 variant, DiCyt2 - H63A,…
7MK4 1.27 Å, Co-bound crystal structure of the engineered cyt cb562 variant, DiCyt2
6DYC 1.33 Å, Co(II)-bound structure of the engineered cyt cb562 variant, CH3
5YO4 1.37 Å, Crystal Structure of B562RIL with engineered disulfide bond K27C-A79C
256B 1.4 Å, Improvement of the 2.5 Å resolution model of cytochrome B562 by redetermining the…
6OT4 1.4 Å, Bimetallic dodecameric cage design 2 (BMC2) from cytochrome cb562
7LRV 1.4 Å, Ni-bound crystal structure of the engineered cyt cb562 variant, DiCyt2, crystallized in…
9PQ4 1.48 Å, Bi-bound structure of the H77C variant of TriCyt2
6DYG 1.49 Å, Fe(II)-bound structure of the engineered cyt cb562 variant, CH3Y

Browse structure collections

About this viewer

MolViewer shows 9V82 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.