9V9C: Human TNFR1 DD filament

Cryo-EM structure of human TNFR1 DD filament. Determined by electron microscopy at 2.62 Å resolution. Released 8 Apr 2026.

Method: Electron microscopy
Resolution: 2.62 Å
Organism: Homo sapiens
Chains: 20
Atoms: 14,360
Mol. weight: 260.72 kDa
Released: 8 Apr 2026

Explore 9V9C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9V9C contains 160 α-helices and 0 β-strands across 20 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S and T: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	356-364	9
α-helix	368-370	3
α-helix	371-378	8
α-helix	382-391	10
α-helix	396-410	15
α-helix	413-415	3
α-helix	418-427	10
α-helix	431-440	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor necrosis factor receptor superfamily member 1A, membrane form	A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T	protein	114	Homo sapiens	P19438 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T), FASTA

>9V9C_1 Tumor necrosis factor receptor superfamily member 1A, membrane form (chains A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T)
EDSAHKPQSLDTDDPATLYAVVENVPPLRWKEFVRRLGLSDHEIDRLELQNGRCLREAQY
SMLATWRRRTPRREATLELLGRVLRDMDLLGCLEDIEEALCGPAALPPAPSLLR

Primary citation

Electric dipole moment drives the dynamics of the TNFR1 complex I signalosome. Liu, J., Zhao, J., Gao, J. et al. Nature (2026) 653:1196-1204. DOI 10.1038/s41586-026-10304-1 · PubMed

Other PDB entries of the same protein (UniProt P19438 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8P6Q 1.4 Å, Racemic structure of TNFR1 cysteine-rich domain
9S3I 1.64 Å, Crystal structure of the human tumor necrosis factor receptor 1 extracellular domain at…
9S3J 1.77 Å, Crystal structure of the human tumor necrosis factor receptor 1 extracellular domain in…
1EXT 1.85 Å, Extracellular domain of the 55KDA tumor necrosis factor receptor. Crystallized at PH3.7…
1NCF 2.25 Å, A new paradigm for tumor necrosis factor signalling
8ZUI 2.56 Å, Binary cluster of TNF-TNFR1 ectodomain complex
7KP7 2.65 Å, asymmetric mTNF-alpha hTNFR1 complex
1TNR 2.85 Å, Crystal structure of the soluble human 55 kd tnf receptor-human tnf-beta complex:…
1FT4 2.9 Å, Photochemically-enhanced binding of small molecules to the tumor necrosis factor…
7KPB 3.0 Å, Human TNF-alpha TNFR1 complex bound to conformationally selective antibody
7KP8 3.15 Å, asymmetric mTNF-alpha hTNFR1 complex
9VIN 3.41 Å, Ternary complex of TNFR1-DD, TRADD-DD and RIPK1-DD

Browse structure collections

About this viewer

MolViewer shows 9V9C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.