9VWO: Human OSM

human OSM in complex with Nb3.30. Determined by X-ray diffraction at 2.45 Å resolution. Released 22 Jul 2026.

Method: X-ray diffraction
Resolution: 2.45 Å
Organisms: Homo sapiens, Vicugna pacos
Chains: 2
Atoms: 2,269
Mol. weight: 33.92 kDa
Released: 22 Jul 2026

Explore 9VWO in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9VWO contains 15 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 0 β-strands

Element	Residues	Length
α-helix	10-24	15
α-helix	27-29	3
α-helix	31-37	7
α-helix	43-45	3
α-helix	47-49	3
α-helix	50-52	3
α-helix	59-64	6
α-helix	67-90	24
α-helix	93-94	2
α-helix	95-98	4
α-helix	105-132	28
α-helix	159-185	27

Chain B: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	1
β-strand	10-11	2	2
β-strand	17-25	9	1
α-helix	29-31	3
β-strand	34-39	6	2
β-strand	46-51	6	2
β-strand	58-60	3	2
α-helix	62-64	3
β-strand	68-73	6	1
β-strand	78-84	7	1
α-helix	88-90	3
β-strand	92-98	7	2
β-strand	109	1	2
β-strand	113-116	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Oncostatin-M	A	protein	187	Homo sapiens	P13725 (AlphaFold model)
Nb3.30	B	protein	119	Vicugna pacos

Sequence of entity 1 (A), FASTA

>9VWO_1 Oncostatin-M (chains A)
AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEE
TLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILG
LRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSV
GRVFSKW

Sequence of entity 2 (B), FASTA

>9VWO_2 Nb3.30 (chains B)
QVQLQESGGGLVQPGGSLRLSCAASGFTFYLSSMSWHRQAPGKERELVAAISTTGSSTDY
ADSVKGRFTISRDNAKNTLYLQMNSLKSEDTALYYCAKGGYYTGTPAYWGQGTQVTVSS

Primary citation

human OSM in complex with Nb3.30. Wen, Y. To be published.

Other PDB entries of the same protein (UniProt P13725 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1EVS 2.2 Å, Crystal structure of human oncostatin M
9VWP 3.03 Å, human OSM in complex with Nb3.43
8V2A 3.59 Å, Cryo-EM structure of human type I OSM receptor complex: model for assembly core region
8V29 3.99 Å, Cryo-EM structure of human type I OSM receptor complex: model for full extracellular…

Browse structure collections

About this viewer

MolViewer shows 9VWO directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.