Crystal structure of Mrt4 (L96C) mutant. Determined by X-ray diffraction at 2.5 Å resolution. Released 4 Feb 2026.
Explore 9XB4 in 3D Show helices and sheets RCSB PDB PDBe
9XB4 contains 20 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 26-33 | 8 | |
| α-helix | 34-36 | 3 | |
| β-strand | 39-46 | 8 | 1 |
| α-helix | 50-59 | 10 | |
| β-strand | 64-66 | 3 | 1 |
| α-helix | 70-77 | 8 | |
| α-helix | 89-95 | 7 | |
| β-strand | 100-105 | 6 | 1 |
| α-helix | 109-118 | 10 | |
| β-strand | 121-123 | 3 | 2 |
| α-helix | 124-126 | 3 | |
| α-helix | 129 | 1 | |
| β-strand | 130 | 1 | 3 |
| α-helix | 131 | 1 | |
| β-strand | 135-137 | 3 | 4 |
| α-helix | 138 | 1 | |
| β-strand | 141 | 1 | 5 |
| α-helix | 142 | 1 | |
| β-strand | 143 | 1 | 6 |
| α-helix | 151-153 | 3 | |
| β-strand | 156 | 1 | 6 |
| α-helix | 157-158 | 2 | |
| α-helix | 159-161 | 3 | |
| α-helix | 162-167 | 6 | |
| β-strand | 173-175 | 3 | 5 |
| β-strand | 178-180 | 3 | 5 |
| β-strand | 192-195 | 4 | 4 |
| α-helix | 199 | 1 | |
| β-strand | 200 | 1 | 3 |
| α-helix | 201 | 1 | |
| α-helix | 203-211 | 9 | |
| β-strand | 217-219 | 3 | 2 |
| β-strand | 220-228 | 9 | 1 |
| β-strand | 233-236 | 4 | 1 |
| α-helix | 238-241 | 4 | |
| α-helix | 244-247 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Large ribosomal subunit protein uL10 | A | protein | 278 | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) | G0S616 (AlphaFold model) |
>9XB4_1 Large ribosomal subunit protein uL10 (chains A) MPKSKRARVYHLTQVNKKGREAKERLFSNIRETIPKYQHCFVFSVDNMRNNYLKDVRHEL NDCRIFFGKTKLMARALGTTPEEEQADGLHRLTRYCTGTVGLLFTNRDPADIESYFSNLS QVDFARAGTVAPRTVTVPPGIVYSTGGEVPPEHDVPVSHTLEPELRRLGMPVRMIKGKVC LGDEKGEASEGYTICKEGEVLDSRQTRLLKLFSICLSEFKVSLLGYWSSASGEVTELEAG KTRPKREGNRRQAMNGDEMDEDQSSDEDSDGSHHHHHH
Inhibiting Mrt4-rRNA interaction with fumaramidmycin-based derivatives as an unexploited antifungal strategy. Cao, H., Hu, X., Li, W. et al. To be published.
Other PDB entries of the same protein (UniProt G0S616 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9XB4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.