9Y5T: EIF2B lacking the latch helix
eIF2B lacking the latch helix bound to ISRACT-02 (Active state). Determined by electron microscopy at 2.78 Å resolution. Released 8 Jul 2026.
- Method
- Electron microscopy
- Resolution
- 2.78 Å
- Organism
- Homo sapiens
- Chains
- 10
- Atoms
- 28,652
- Mol. weight
- 524.13 kDa
- Ligands
- PO4, A1CSR, ZN
- Released
- 8 Jul 2026
Explore 9Y5T in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9Y5T contains 191 α-helices and 230 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 17 helices, 37 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 44-48 | 5 | 1 |
| α-helix | 59-61 | 3 | |
| α-helix | 65-67 | 3 | |
| β-strand | 69-70 | 2 | 2 |
| β-strand | 73-74 | 2 | 2 |
| α-helix | 75-85 | 11 | |
| β-strand | 90-95 | 6 | 1 |
| α-helix | 99-107 | 9 | |
| α-helix | 110-112 | 3 | |
| β-strand | 119-124 | 6 | 1 |
| α-helix | 131-141 | 11 | |
| β-strand | 148-152 | 5 | 1 |
| β-strand | 155-157 | 3 | 3 |
| α-helix | 162-174 | 13 | |
| β-strand | 179-187 | 9 | 1 |
| α-helix | 197-199 | 3 | |
| β-strand | 201-206 | 6 | 1 |
| β-strand | 211-217 | 7 | 1 |
| β-strand | 223-227 | 5 | 4 |
| α-helix | 228-231 | 4 | |
| β-strand | 238-241 | 4 | 1 |
| β-strand | 244-252 | 9 | 1 |
| α-helix | 255-262 | 8 | |
| α-helix | 269-278 | 10 | |
| α-helix | 280-283 | 4 | |
| β-strand | 286-292 | 7 | 1 |
| β-strand | 297-299 | 3 | 3 |
| α-helix | 303-314 | 12 | |
| α-helix | 323-325 | 3 | |
| α-helix | 331-333 | 3 | |
| β-strand | 336-338 | 3 | 5 |
| β-strand | 342-344 | 3 | 5 |
| β-strand | 349-350 | 2 | 6 |
| β-strand | 355-356 | 2 | 7 |
| β-strand | 360-362 | 3 | 5 |
| β-strand | 367-368 | 2 | 6 |
| β-strand | 373-375 | 3 | 7 |
| β-strand | 378-379 | 2 | 5 |
| β-strand | 384-385 | 2 | 6 |
| β-strand | 390-392 | 3 | 7 |
| β-strand | 395-396 | 2 | 5 |
| β-strand | 401-402 | 2 | 6 |
| β-strand | 407-409 | 3 | 7 |
| β-strand | 412-413 | 2 | 5 |
| β-strand | 418-419 | 2 | 6 |
| β-strand | 424-425 | 2 | 7 |
| β-strand | 430-431 | 2 | 5 |
| β-strand | 436-437 | 2 | 6 |
| β-strand | 442-443 | 2 | 7 |
| α-helix | 444 | 1 | |
| β-strand | 448-450 | 3 | 5 |
| α-helix | 485-488 | 4 | |
| β-strand | 493 | 1 | 6 |
| β-strand | 495-497 | 3 | 5 |
Chain B: 17 helices, 37 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 40-43 | 4 | |
| β-strand | 44-48 | 5 | 8 |
| α-helix | 59-61 | 3 | |
| α-helix | 65-67 | 3 | |
| β-strand | 69-70 | 2 | 9 |
| β-strand | 73-74 | 2 | 9 |
| α-helix | 75-85 | 11 | |
| β-strand | 90-95 | 6 | 8 |
| α-helix | 99-107 | 9 | |
| α-helix | 110-112 | 3 | |
| β-strand | 119-124 | 6 | 8 |
| α-helix | 131-140 | 10 | |
| β-strand | 148-152 | 5 | 8 |
| β-strand | 155-157 | 3 | 10 |
| α-helix | 162-174 | 13 | |
| β-strand | 179-187 | 9 | 8 |
| α-helix | 197-199 | 3 | |
| β-strand | 201-206 | 6 | 8 |
| β-strand | 211-217 | 7 | 8 |
| β-strand | 223-227 | 5 | 11 |
| α-helix | 228-231 | 4 | |
| β-strand | 238-241 | 4 | 8 |
| β-strand | 244-252 | 9 | 8 |
| α-helix | 255-262 | 8 | |
| α-helix | 269-283 | 15 | |
| β-strand | 286-292 | 7 | 8 |
| β-strand | 297-299 | 3 | 10 |
| α-helix | 303-314 | 12 | |
| α-helix | 323-325 | 3 | |
| α-helix | 331-333 | 3 | |
| β-strand | 336-338 | 3 | 12 |
| β-strand | 342-344 | 3 | 12 |
| β-strand | 349-350 | 2 | 13 |
| β-strand | 355-356 | 2 | 14 |
| β-strand | 360-362 | 3 | 12 |
| β-strand | 367-368 | 2 | 13 |
| β-strand | 373-375 | 3 | 14 |
| β-strand | 378-379 | 2 | 12 |
| β-strand | 384-385 | 2 | 13 |
| β-strand | 390-392 | 3 | 14 |
| β-strand | 395-396 | 2 | 12 |
| β-strand | 401-402 | 2 | 13 |
| β-strand | 407-409 | 3 | 14 |
| β-strand | 412-413 | 2 | 12 |
| β-strand | 418-419 | 2 | 13 |
| β-strand | 424-425 | 2 | 14 |
| β-strand | 430-431 | 2 | 12 |
| β-strand | 436-437 | 2 | 13 |
| β-strand | 442-443 | 2 | 14 |
| α-helix | 444 | 1 | |
| β-strand | 448-450 | 3 | 12 |
| α-helix | 485-488 | 4 | |
| β-strand | 493 | 1 | 13 |
| β-strand | 495-497 | 3 | 12 |
Chain C: 19 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-23 | 15 | |
| α-helix | 31-47 | 17 | |
| α-helix | 54-71 | 18 | |
| α-helix | 76-97 | 22 | |
| α-helix | 129-144 | 16 | |
| α-helix | 147-152 | 6 | |
| α-helix | 155-157 | 3 | |
| β-strand | 163-168 | 6 | 15 |
| α-helix | 172-181 | 10 | |
| β-strand | 187-192 | 6 | 15 |
| α-helix | 199-209 | 11 | |
| β-strand | 213-217 | 5 | 15 |
| α-helix | 219-221 | 3 | |
| α-helix | 222-226 | 5 | |
| β-strand | 231-234 | 4 | 15 |
| β-strand | 238-239 | 2 | 16 |
| β-strand | 245-248 | 4 | 16 |
| α-helix | 251-260 | 10 | |
| β-strand | 265-268 | 4 | 15 |
| α-helix | 271-273 | 3 | |
| β-strand | 274 | 1 | 16 |
| β-strand | 288 | 1 | 17 |
| α-helix | 291-293 | 3 | |
| α-helix | 297-304 | 8 | |
| β-strand | 307-308 | 2 | 18 |
| β-strand | 311 | 1 | 17 |
| β-strand | 313-316 | 4 | 16 |
| α-helix | 318-320 | 3 | |
| β-strand | 323-326 | 4 | 15 |
| β-strand | 329-331 | 3 | 15 |
| α-helix | 333-335 | 3 | |
| α-helix | 336-343 | 8 | |
| α-helix | 346-348 | 3 | |
Chain D: 21 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-23 | 15 | |
| α-helix | 31-48 | 18 | |
| α-helix | 54-71 | 18 | |
| α-helix | 76-97 | 22 | |
| α-helix | 118-120 | 3 | |
| α-helix | 129-145 | 17 | |
| α-helix | 147-152 | 6 | |
| α-helix | 155-157 | 3 | |
| β-strand | 164-168 | 5 | 19 |
| α-helix | 172-181 | 10 | |
| β-strand | 188-192 | 5 | 19 |
| α-helix | 200-209 | 10 | |
| β-strand | 213-217 | 5 | 19 |
| α-helix | 219-221 | 3 | |
| α-helix | 222-226 | 5 | |
| β-strand | 231-234 | 4 | 19 |
| β-strand | 238-239 | 2 | 20 |
| β-strand | 245-248 | 4 | 20 |
| α-helix | 251-260 | 10 | |
| β-strand | 265-268 | 4 | 19 |
| α-helix | 271-273 | 3 | |
| β-strand | 274 | 1 | 20 |
| α-helix | 283-285 | 3 | |
| β-strand | 288 | 1 | 21 |
| α-helix | 291-293 | 3 | |
| α-helix | 297-304 | 8 | |
| β-strand | 307-308 | 2 | 22 |
| β-strand | 311 | 1 | 21 |
| β-strand | 313-316 | 4 | 20 |
| α-helix | 318-320 | 3 | |
| β-strand | 323-326 | 4 | 19 |
| β-strand | 329-331 | 3 | 19 |
| α-helix | 333-335 | 3 | |
| α-helix | 336-343 | 8 | |
| α-helix | 346-348 | 3 | |
Chain E: 24 helices, 17 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 168-172 | 5 | |
| α-helix | 175-177 | 3 | |
| α-helix | 178-180 | 3 | |
| β-strand | 185 | 1 | 23 |
| α-helix | 192-194 | 3 | |
| α-helix | 205-215 | 11 | |
| α-helix | 222-239 | 18 | |
| α-helix | 242-243 | 2 | |
| α-helix | 248-266 | 19 | |
| α-helix | 268-270 | 3 | |
| α-helix | 271-285 | 15 | |
| α-helix | 293-308 | 16 | |
| α-helix | 309-314 | 6 | |
| α-helix | 315-323 | 9 | |
| β-strand | 332-336 | 5 | 22 |
| α-helix | 340-351 | 12 | |
| β-strand | 357-362 | 6 | 22 |
| α-helix | 369-379 | 11 | |
| β-strand | 383-387 | 5 | 22 |
| α-helix | 388-390 | 3 | |
| α-helix | 391-394 | 4 | |
| β-strand | 400-404 | 5 | 22 |
| β-strand | 407-409 | 3 | 24 |
| β-strand | 414-417 | 4 | 24 |
| α-helix | 420-429 | 10 | |
| β-strand | 434-437 | 4 | 22 |
| α-helix | 440-442 | 3 | |
| β-strand | 443-444 | 2 | 24 |
| β-strand | 457 | 1 | 23 |
| α-helix | 460-463 | 4 | |
| β-strand | 466-467 | 2 | 25 |
| β-strand | 470-471 | 2 | 25 |
| α-helix | 476-478 | 3 | |
| β-strand | 482-484 | 3 | 19 |
| β-strand | 487 | 1 | 23 |
| β-strand | 489-492 | 4 | 24 |
| α-helix | 494-496 | 3 | |
| β-strand | 499-502 | 4 | 22 |
| β-strand | 505-507 | 3 | 22 |
| α-helix | 509-511 | 3 | |
| α-helix | 512-519 | 8 | |
Chain F: 22 helices, 17 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 168-172 | 5 | |
| α-helix | 178-180 | 3 | |
| β-strand | 185 | 1 | 26 |
| α-helix | 192-195 | 4 | |
| α-helix | 205-215 | 11 | |
| α-helix | 222-239 | 18 | |
| α-helix | 248-266 | 19 | |
| α-helix | 268-270 | 3 | |
| α-helix | 271-285 | 15 | |
| α-helix | 293-308 | 16 | |
| α-helix | 309-313 | 5 | |
| α-helix | 314-323 | 10 | |
| β-strand | 332-336 | 5 | 18 |
| α-helix | 340-351 | 12 | |
| β-strand | 357-362 | 6 | 18 |
| α-helix | 369-378 | 10 | |
| β-strand | 383-387 | 5 | 18 |
| α-helix | 388-390 | 3 | |
| α-helix | 391-394 | 4 | |
| β-strand | 400-404 | 5 | 18 |
| β-strand | 407-409 | 3 | 27 |
| β-strand | 414-417 | 4 | 27 |
| α-helix | 420-429 | 10 | |
| β-strand | 434-437 | 4 | 18 |
| α-helix | 440-442 | 3 | |
| β-strand | 443-444 | 2 | 27 |
| β-strand | 457 | 1 | 26 |
| α-helix | 460-463 | 4 | |
| β-strand | 466-467 | 2 | 28 |
| β-strand | 470-471 | 2 | 28 |
| α-helix | 476-478 | 3 | |
| β-strand | 482-484 | 3 | 15 |
| β-strand | 487 | 1 | 26 |
| β-strand | 489-492 | 4 | 27 |
| α-helix | 494-496 | 3 | |
| β-strand | 499-502 | 4 | 18 |
| β-strand | 505-507 | 3 | 18 |
| α-helix | 509-511 | 3 | |
| α-helix | 512-519 | 8 | |
Chain G: 17 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-15 | 13 | |
| α-helix | 22-36 | 15 | |
| α-helix | 42-59 | 18 | |
| α-helix | 63-77 | 15 | |
| α-helix | 86-115 | 30 | |
| α-helix | 116-118 | 3 | |
| β-strand | 124-127 | 4 | 29 |
| α-helix | 132-143 | 12 | |
| β-strand | 149-153 | 5 | 29 |
| α-helix | 160-170 | 11 | |
| β-strand | 175-178 | 4 | 29 |
| α-helix | 180-182 | 3 | |
| α-helix | 183-186 | 4 | |
| α-helix | 187-189 | 3 | |
| β-strand | 192-195 | 4 | 29 |
| β-strand | 199-200 | 2 | 30 |
| β-strand | 206-209 | 4 | 30 |
| α-helix | 212-221 | 10 | |
| β-strand | 226-229 | 4 | 29 |
| α-helix | 232-234 | 3 | |
| β-strand | 235 | 1 | 30 |
| α-helix | 243-245 | 3 | |
| α-helix | 248-251 | 4 | |
| β-strand | 267-269 | 3 | 31 |
| β-strand | 273-276 | 4 | 30 |
| α-helix | 278-280 | 3 | |
| β-strand | 283-286 | 4 | 29 |
| β-strand | 289-291 | 3 | 29 |
| α-helix | 293-303 | 11 | |
Chain H: 17 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-16 | 14 | |
| α-helix | 22-36 | 15 | |
| α-helix | 42-59 | 18 | |
| α-helix | 63-77 | 15 | |
| α-helix | 86-104 | 19 | |
| α-helix | 107-115 | 9 | |
| β-strand | 124-127 | 4 | 31 |
| α-helix | 132-143 | 12 | |
| β-strand | 149-153 | 5 | 31 |
| α-helix | 160-170 | 11 | |
| β-strand | 175-178 | 4 | 31 |
| α-helix | 180-182 | 3 | |
| α-helix | 183-186 | 4 | |
| α-helix | 187-189 | 3 | |
| β-strand | 192-195 | 4 | 31 |
| β-strand | 199-200 | 2 | 32 |
| β-strand | 206-209 | 4 | 32 |
| α-helix | 212-221 | 10 | |
| β-strand | 226-229 | 4 | 31 |
| α-helix | 232-234 | 3 | |
| β-strand | 235 | 1 | 32 |
| α-helix | 243-245 | 3 | |
| α-helix | 248-251 | 4 | |
| β-strand | 267-269 | 3 | 29 |
| β-strand | 273-276 | 4 | 32 |
| α-helix | 278-280 | 3 | |
| β-strand | 283-286 | 4 | 31 |
| β-strand | 289-291 | 3 | 31 |
| α-helix | 293-303 | 11 | |
2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Translation initiation factor eIF-2B subunit epsilon | A, B | protein | 721 | Homo sapiens | Q13144 (AlphaFold model) |
| Translation initiation factor eIF2B subunit beta | C, D | protein | 355 | Homo sapiens | P49770 (AlphaFold model) |
| Translation initiation factor eIF-2B subunit delta | E, F | protein | 523 | Homo sapiens | Q9UI10 (AlphaFold model) |
| Translation initiation factor eIF-2B subunit alpha | G, H | protein | 305 | Homo sapiens | Q14232 (AlphaFold model) |
| Translation initiation factor eIF-2B subunit gamma | I, J | protein | 452 | Homo sapiens | Q9NR50 |
Sequence of entity 1 (A, B), FASTA
>9Y5T_1 Translation initiation factor eIF-2B subunit epsilon (chains A, B)
MAAPVVAPPGVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPIS
KDQPRVLLPLANVALIDYTLEFLTATGVQETFVFCCWKAAQIKEHLLKSKWCRPTSLNVV
RIITSELYRSLGDVLRDVDAKALVRSDFLLVYGDVISNINITRALEEHRLRRKLEKNVSV
MTMIFKESSPSHPTRCHEDNVVVAVDSTTNRVLHFQKTQGLRRFAFPLSLFQGSSDGVEV
RYDLLDCHISICSPQVAQLFTDNFDYQTRDDFVRGLLVNEEILGNQIHMHVTAKEYGARV
SNLHMYSAVCADVIRRWVYPLTPEANFTDSTTQSCTHSRHNIYRGPEVSLGHGSILEENV
LLGSGTVIGSNCFITNSVIGPGCHIGDNVVLDQTYLWQGVRVAAGAQIHQSLLCDNAEVK
ERVTLKPRSVLTSQVVVGPNITLPEGSVISLHPPDAEEDEDDGEFSDDSGADQEKDKVKM
KGYNPAEVGAAGKGYLWKAAGMNMEEEEELQQNLWGLKINMEEESESESEQSMDSEEPDS
RGGSPQMDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNVSLKEVMQVLSHVV
LEFPLQQMDSPLDSSRYCALLLPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHEALG
ISMAKVLMAFYQLEILAEETILSWFSQRDTTDKGQQLRKNQQLQRFIQWLKEAEEESSED
D
Sequence of entity 2 (C, D), FASTA
>9Y5T_2 Translation initiation factor eIF2B subunit beta (chains C, D)
MHHHHHHGGGSENLYFQSPGSAAKGSELSERIESFVETLKRGGGPRSSEEMARETLGLLR
QIITDHRWSNAGELMELIRREGRRMTAAQPSETTVGNMVRRVLKIIREEYGRLHGRGSGS
GLNEDFSFHYAQLQSNIIEAINELLVELEGTMENIAAQALEHIHSNEVIMTIGFSRTVEA
FLKEAARKRKFHVIVAECAPFCQGHEMAVNLSKAGIETTVMTDAAIFAVMSRVNKVIIGT
KTILANGALRAVTGTHTLALAAKHHSTPLIVCAPMFKLSPQFPNEEDSFHKFVAPEEVLP
FTEGDILEKVSVHCPVFDYVPPELITLFISNIGGNAPSYIYRLMSELYHPDDHVL
Sequence of entity 3 (E, F), FASTA
>9Y5T_3 Translation initiation factor eIF-2B subunit delta (chains E, F)
MAAVAVAVREDSGSGMKAELPPGPGAVGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPET
GSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAELRAERRAKQEAERALKQARKG
EQGGPPPKASPSTAGETPSGVKRLPEYPQVDDLLLRRLVKKPERQQVPTRKDYGSKVSLF
SHLPQYSRQNSLTQFMSIPSSVIHPAMVRLGLQYSQGLVSGSNARCIALLRALQQVIQDY
TTPPNEELSRDLVNKLKPYMSFLTQCRPLSASMHNAIKFLNKEITSVGSSKREEEAKSEL
RAAIDRYVQEKIVLAAQAISRFAYQKISNGDVILVYGCSSLVSRILQEAWTEGRRFRVVV
VDSRPWLEGRHTLRSLVHAGVPASYLLIPAASYVLPEVSKVLLGAHALLANGSVMSRVGT
AQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNELDDPDDLQCKRGEHVALANWQNHA
SLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVLRVKSSDQ
Sequence of entity 4 (G, H), FASTA
>9Y5T_4 Translation initiation factor eIF-2B subunit alpha (chains G, H)
MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVD
SSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIK
DGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLD
AAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFP
LNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDEL
IKLYL
Sequence of entity 5 (I, J), FASTA
>9Y5T_5 Translation initiation factor eIF-2B subunit gamma (chains I, J)
MEFQAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVVTTRDVQ
KALCAEFKMKMKPDIVCIPDDADMGTADSLRYIYPKLKTDVLVLSCDLITDVALHEVVDL
FRAYDASLAMLMRKGQDSIEPVPGQKGKKKAVEQRDFIGVDSTGKRLLFMANEADLDEEL
VIKGSILQKHPRIRFHTGLVDAHLYCLKKYIVDFLMENGSITSIRSELIPYLVRKQFSSA
SSQQGQEEKEEDLKKKELKSLDIYSFIKEANTLNLAPYDACWNACRGDRWEDLSRSQVRC
YVHIMKEGLCSRVSTLGLYMEANRQVPKLLSALCPEEPPVHSSAQIVSKHLVGVDSLIGP
ETQIGEKSSIKRSVIGSSCLIKDRVTITNCLLMNSVTVEEGSNIQGSVICNNAVIEKGAD
IKDCLIGSGQRIEAKAKRVNEVIVGNDQLMEI
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| PO4 | Phosphate ion | O4 P | 2 |
| A1CSR | 3-(4-chlorophenoxy)-N-{(1r,4r)-4-[2-(4-chlorophenoxy)acetamido]cyclohexyl}-N-[(… | C29 H31 Cl2 N3 O4 | 1 |
| ZN | Zinc ion | Zn | 2 |
Water and common crystallization additives (CL) are not listed.
Primary citation
Allosteric disordering of eIF2B regulates the integrated stress response. Dalwadi, U., Subramanian, A., Deal, A. et al. Nat Chem Biol (2026). DOI 10.1038/s41589-026-02256-4 · PubMed
Other PDB entries of the same protein (UniProt Q13144 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3JUI 2.0 Å, Crystal Structure of the C-terminal Domain of Human Translation Initiation Factor eIF2B…
- 9Y4B 2.1 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
- 7VLK 2.27 Å, eIF2B-SFSV NSs C2-imposed
- 9Y3U 2.4 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
- 9Y4W 2.4 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
- 7F64 2.42 Å, eIF2B-SFSV NSs
- 9Y3T 2.5 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
- 7RLO 2.6 Å, Structure of the human eukaryotic translation initiation factor 2B (eIF2B) in complex…
- 9HVE 2.7 Å, Native human eIF2-eIF2B complex
- 7F66 2.76 Å, eIF2B-SFSV NSs-1-eIF2
- 6CAJ 2.8 Å, Electron cryo-microscopy of the eukaryotic translation initiation factor 2B from Homo…
- 7L70 2.8 Å, The eukaryotic translation initiation factor 2B from Homo sapiens in its apo form
Browse structure collections
About this viewer
MolViewer shows 9Y5T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.