9YK9: Actin, alpha cardiac muscle 1
The structure of the cardiac native crossbridge in the rigor state, myosin heads bound to actin molecules 1 and 2. Determined by electron microscopy at 4.5 Å resolution. Released 22 Jul 2026.
- Method
- Electron microscopy
- Resolution
- 4.5 Å
- Organism
- Sus scrofa
- Chains
- 13
- Atoms
- 30,678
- Mol. weight
- 825.93 kDa
- Ligands
- MG, ADP
- Released
- 22 Jul 2026
Explore 9YK9 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9YK9 contains 200 α-helices and 139 β-strands across 13 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 23 helices, 19 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 8-11 | 4 | 1 |
| β-strand | 16-21 | 6 | 1 |
| β-strand | 29-32 | 4 | 1 |
| β-strand | 35-38 | 4 | 2 |
| β-strand | 53-54 | 2 | 2 |
| α-helix | 62-64 | 3 | |
| β-strand | 65-68 | 4 | 2 |
| β-strand | 71 | 1 | 3 |
| β-strand | 76 | 1 | 3 |
| α-helix | 79-88 | 10 | |
| α-helix | 89-93 | 5 | |
| α-helix | 98-100 | 3 | |
| β-strand | 103-107 | 5 | 1 |
| α-helix | 114-125 | 12 | |
| β-strand | 131-136 | 6 | 1 |
| α-helix | 139-144 | 6 | |
| β-strand | 149-155 | 7 | 4 |
| β-strand | 160-166 | 7 | 4 |
| β-strand | 169-170 | 2 | 4 |
| α-helix | 172-174 | 3 | |
| β-strand | 176-178 | 3 | 4 |
| α-helix | 182-191 | 10 | |
| α-helix | 192-196 | 5 | |
| α-helix | 203-205 | 3 | |
| α-helix | 206-216 | 11 | |
| α-helix | 223-232 | 10 | |
| β-strand | 238-242 | 5 | 5 |
| β-strand | 245-250 | 6 | 5 |
| α-helix | 253-256 | 4 | |
| α-helix | 258-261 | 4 | |
| α-helix | 264-266 | 3 | |
| α-helix | 274-283 | 10 | |
| α-helix | 290-293 | 4 | |
| β-strand | 297-300 | 4 | 4 |
| α-helix | 309-320 | 12 | |
| β-strand | 329-330 | 2 | 4 |
| α-helix | 335-337 | 3 | |
| α-helix | 340-346 | 7 | |
| α-helix | 350-354 | 5 | |
| β-strand | 357-358 | 2 | 1 |
| α-helix | 359-362 | 4 | |
| α-helix | 366-371 | 6 | |
Chain B: 24 helices, 20 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 8-9 | 2 | 6 |
| β-strand | 10-11 | 2 | 7 |
| β-strand | 16-19 | 4 | 7 |
| β-strand | 29-32 | 4 | 7 |
| β-strand | 35-38 | 4 | 8 |
| β-strand | 53-54 | 2 | 8 |
| α-helix | 55-60 | 6 | |
| α-helix | 62-64 | 3 | |
| β-strand | 65-68 | 4 | 8 |
| β-strand | 71 | 1 | 9 |
| β-strand | 76 | 1 | 9 |
| α-helix | 79-88 | 10 | |
| α-helix | 89-94 | 6 | |
| β-strand | 103-107 | 5 | 6 |
| α-helix | 114-122 | 9 | |
| α-helix | 123-127 | 5 | |
| β-strand | 131-136 | 6 | 6 |
| α-helix | 137-144 | 8 | |
| β-strand | 149-155 | 7 | 10 |
| β-strand | 160-166 | 7 | 10 |
| β-strand | 169-170 | 2 | 10 |
| α-helix | 172-174 | 3 | |
| β-strand | 176-178 | 3 | 10 |
| α-helix | 182-192 | 11 | |
| α-helix | 193-196 | 4 | |
| α-helix | 206-216 | 11 | |
| α-helix | 223-230 | 8 | |
| β-strand | 238-242 | 5 | 11 |
| β-strand | 245-250 | 6 | 11 |
| α-helix | 253-256 | 4 | |
| α-helix | 258-261 | 4 | |
| α-helix | 264-267 | 4 | |
| α-helix | 274-284 | 11 | |
| α-helix | 290-295 | 6 | |
| β-strand | 297-299 | 3 | 10 |
| α-helix | 303-305 | 3 | |
| α-helix | 309-318 | 10 | |
| β-strand | 329-330 | 2 | 10 |
| α-helix | 335-337 | 3 | |
| α-helix | 338-348 | 11 | |
| α-helix | 350-354 | 5 | |
| β-strand | 357-358 | 2 | 6 |
| α-helix | 359-362 | 4 | |
| α-helix | 366-371 | 6 | |
Chain C: 24 helices, 19 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 8-11 | 4 | 12 |
| β-strand | 16-21 | 6 | 12 |
| β-strand | 29-32 | 4 | 12 |
| β-strand | 35-38 | 4 | 13 |
| β-strand | 53-54 | 2 | 13 |
| α-helix | 56-60 | 5 | |
| α-helix | 62-64 | 3 | |
| β-strand | 65-68 | 4 | 13 |
| β-strand | 71 | 1 | 14 |
| β-strand | 76 | 1 | 14 |
| α-helix | 80-88 | 9 | |
| α-helix | 89-93 | 5 | |
| β-strand | 103-107 | 5 | 12 |
| α-helix | 113-122 | 10 | |
| α-helix | 123-127 | 5 | |
| β-strand | 131-136 | 6 | 12 |
| α-helix | 137-145 | 9 | |
| β-strand | 150-155 | 6 | 15 |
| β-strand | 160-166 | 7 | 15 |
| β-strand | 169-170 | 2 | 15 |
| α-helix | 172-174 | 3 | |
| β-strand | 176-178 | 3 | 15 |
| α-helix | 182-192 | 11 | |
| α-helix | 193-196 | 4 | |
| α-helix | 206-215 | 10 | |
| α-helix | 223-232 | 10 | |
| β-strand | 238-242 | 5 | 16 |
| β-strand | 245-250 | 6 | 16 |
| α-helix | 253-256 | 4 | |
| α-helix | 258-261 | 4 | |
| α-helix | 264-266 | 3 | |
| α-helix | 274-283 | 10 | |
| α-helix | 290-295 | 6 | |
| β-strand | 297-300 | 4 | 15 |
| α-helix | 302-304 | 3 | |
| α-helix | 309-318 | 10 | |
| β-strand | 329-330 | 2 | 15 |
| α-helix | 335-337 | 3 | |
| α-helix | 338-346 | 9 | |
| α-helix | 351-355 | 5 | |
| β-strand | 357-358 | 2 | 12 |
| α-helix | 359-365 | 7 | |
| α-helix | 367-371 | 5 | |
Chain D: 23 helices, 21 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 8-11 | 4 | 17 |
| β-strand | 16-21 | 6 | 17 |
| β-strand | 22 | 1 | 18 |
| β-strand | 24 | 1 | 18 |
| β-strand | 29-32 | 4 | 17 |
| β-strand | 35-38 | 4 | 19 |
| β-strand | 53-54 | 2 | 19 |
| α-helix | 55-59 | 5 | |
| β-strand | 65-68 | 4 | 19 |
| β-strand | 71 | 1 | 20 |
| β-strand | 76 | 1 | 20 |
| α-helix | 79-88 | 10 | |
| α-helix | 89-94 | 6 | |
| α-helix | 98-100 | 3 | |
| β-strand | 103-105 | 3 | 17 |
| α-helix | 114-125 | 12 | |
| β-strand | 131-134 | 4 | 17 |
| α-helix | 137-144 | 8 | |
| β-strand | 149-155 | 7 | 21 |
| β-strand | 160-166 | 7 | 21 |
| β-strand | 169-170 | 2 | 21 |
| α-helix | 172-174 | 3 | |
| β-strand | 176-178 | 3 | 21 |
| α-helix | 184-192 | 9 | |
| α-helix | 193-196 | 4 | |
| α-helix | 203-205 | 3 | |
| α-helix | 206-216 | 11 | |
| α-helix | 223-232 | 10 | |
| β-strand | 238-241 | 4 | 22 |
| β-strand | 247-250 | 4 | 22 |
| α-helix | 253-256 | 4 | |
| α-helix | 258-261 | 4 | |
| α-helix | 274-283 | 10 | |
| α-helix | 287-289 | 3 | |
| α-helix | 293-295 | 3 | |
| β-strand | 297-300 | 4 | 21 |
| α-helix | 302-305 | 4 | |
| α-helix | 309-320 | 12 | |
| β-strand | 329-330 | 2 | 21 |
| α-helix | 338-346 | 9 | |
| α-helix | 352-354 | 3 | |
| β-strand | 357-358 | 2 | 17 |
| α-helix | 359-365 | 7 | |
| α-helix | 367-369 | 3 | |
Chain E: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 251-283 | 33 | |
Chain F: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 251-281 | 31 | |
Chain G: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-154 | 152 | |
Chain H: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-154 | 153 | |
5 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Actin, alpha cardiac muscle 1 | A, B, C, D | protein | 377 | Sus scrofa | B6VNT8 (AlphaFold model) |
| Tropomyosin alpha-1 chain | E, F, G, H | protein | 284 | Sus scrofa | P42639 (AlphaFold model) |
| Troponin T2, cardiac type | I | protein | 285 | Sus scrofa | A0A5G2Q8N0 (AlphaFold model) |
| Myosin-7 | J, K | protein | 1935 | Sus scrofa | P79293 (AlphaFold model) |
| Myosin light chain 3 | L, M | protein | 196 | Sus scrofa | F1SNW4 |
Sequence of entity 1 (A, B, C, D), FASTA
>9YK9_1 Actin, alpha cardiac muscle 1 (chains A, B, C, D)
MCDDEETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEA
QSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREK
MTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRL
DLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEK
SYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNV
LSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWIS
KQEYDEAGPSIVHRKCF
Sequence of entity 2 (E, F, G, H), FASTA
>9YK9_2 Tropomyosin alpha-1 chain (chains E, F, G, H)
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKRLEDELVSLQKKLKATEDELDKY
SEAPKDAQEKLELAEKKATDAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE
ERAELSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDKYEEEIKVLSDKLKEAETRAE
FAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI
Sequence of entity 3 (I), FASTA
>9YK9_3 Troponin T2, cardiac type (chains I)
MSDVEETVDEYEEEQEEGAAEEQEEAVEEEAGGEAEAEEANAEEAGQEEDGREAEDGPME
ESKPKPRLFMPNLVPPKIPDGERVDFDDIHRKRMKDLNELQTLIEAHFENRKKEEELVSL
KDRIEKRRAERAEQQRIRTEREKERQTRLAEERARREEEENRRKAEDEARKKKALSNMMH
FGGYIQKQAQTERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQSIYNL
EAEKFDLQEKFKQQKYEINVLRNRINDNQKVSKTRGKAKVTGRWK
Sequence of entity 4 (J, K), FASTA
>9YK9_4 Myosin-7 (chains J, K)
MVDAEMAAFGEAAPYLRKSEKERLEAQTRPFDLKKDVYVPDDKEEFVKAKILSREGGKVT
AETEHGKTVTVKEDQVLQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYASWMIYTYSGL
FCVTINPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGES
GAGKTVNTKRVIQYFAVIAAIGDRSKKEQTPGKGTLEDQIIQANPALEAFGNAKTVRNDN
SSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDM
LLITNNPYDYAFISQGETTVASIDDAEELMATDNAFDVLGFTSEEKNSMYKLTGAIMHFG
NMKFKLKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQV
MYATGALAKAVYEKMFNWMVTRINTTLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINF
TNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMF
PKATDMTFKAKLYDNHLGKSNNFQKPRNIKGRPEAHFALIHYAGTVDYNIIGWLQKNKDP
LNETVVDLYKKSSLKLLSNLFANYAGADTPVEKGKGKAKKGSSFQTVSALHRENLNKLMT
NLRSTHPHFVRCIIPNETKSPGVIDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQ
RYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDER
LSRIITRIQAQSRGVLSRMEFKKLLERRDSLLIIQWNIRAFMSVKNWPWMKLYFKIKPLL
KSAETEKEMATMKEEFGRLKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLAD
AEERCDQLIKNKIQLEAKVKEMTERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELT
LAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTL
TKAKVKLEQHVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKQQLDERL
KKKDFELNALNARIEDEQALGSQLQKKLKELQARIEELEEELEAERTARAKVEKLRSDLS
RELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSV
AELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHR
SKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLE
EEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAI
QRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAA
ALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKR
ENKNLQEEISDLTEQLGSSGKTIHELEKVRKQLEAEKLELQSALEEAEASLEHEEGKILR
AQLEFNQIKAEMERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAETRSRNEALRVKKKMEG
DLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNL
LQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMEADLSQLQTE
VEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEA
EQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDRKN
LLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKL
RAKSRDIGTKGLNEE
Sequence of entity 5 (L, M), FASTA
>9YK9_5 Myosin light chain 3 (chains L, M)
MAPKKPEPKKDDAKAAAKAAPAPAPAPAPAPEPKEPEFDASKIKIEFTPEQIEEFKEAFM
LFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPKQEELNSKMMDFDTFLPMLQ
HISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGERLTEDEVEKLMAGQEDS
NGCINYEAFVKHIMAS
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| MG | Magnesium ion | Mg | 4 |
| ADP | Adenosine-5'-diphosphate | C10 H15 N5 O10 P2 | 4 |
Primary citation
The structure of the native cardiac crossbridge in the rigor state. Risi, C.M., Nguyen, T., Belknap, B. et al. Sci Adv (2026) 12:eaeg1209-eaeg1209. DOI 10.1126/sciadv.aeg1209 · PubMed
Other PDB entries of the same protein (UniProt B6VNT8 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 8EFI 3.4 Å, Helical reconstruction of the human cardiac actin-tropomyosin-myosin complex in the…
- 8ENC 3.6 Å, Helical reconstruction of the human cardiac actin-tropomyosin-myosin loop 4 7G mutant…
- 7JH7 3.8 Å, cardiac actomyosin complex
- 9YA8 4.32 Å, The structure of the cardiac native crossbridge in the rigor state, myosin heads bound…
- 9YAQ 4.63 Å, The structure of the cardiac native cross bridge in the rigor state, myosin heads bound…
- 9YJP 4.8 Å, The structure of the cardiac native crossbridge in the rigor state, myosin heads bound…
- 9YKN 5.3 Å, The structure of the cardiac native crossbridge in the rigor state, myosin heads with…
- 7LRG 6.1 Å, Filamentous actin decorated with human cardiac myosin binding protein C C2 domain
Browse structure collections
About this viewer
MolViewer shows 9YK9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.