BCL11A ZF4-6 in Complex with a DNA Sequence Observed in the Human Globin Locus Containing Motif TGTCCA (12-mer). Determined by X-ray diffraction at 1.91 Å resolution. Released 4 Mar 2026.
Explore 9YLM in 3D Show helices and sheets RCSB PDB PDBe
9YLM contains 4 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 743 | 1 | 1 |
| β-strand | 750 | 1 | 1 |
| α-helix | 754-765 | 12 | |
| β-strand | 770-771 | 2 | 2 |
| β-strand | 778-779 | 2 | 2 |
| α-helix | 782-789 | 8 | |
| α-helix | 790-792 | 3 | |
| β-strand | 800-801 | 2 | 3 |
| β-strand | 808-809 | 2 | 3 |
| α-helix | 812-822 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| B-cell lymphoma/leukemia 11A | A | protein | 108 | Homo sapiens | Q9H165 (AlphaFold model) |
| DNA Strand II | E | DNA | 13 | Homo sapiens | |
| DNA Strand I | F | DNA | 13 | Homo sapiens |
>9YLM_1 B-cell lymphoma/leukemia 11A (chains A) GSPGRPSSKEGRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLTR HMKTHGQVGKDVYKCEICKMPFSVYSTLEKHMKKWHSDRVLNNDIKTE
>9YLM_2 DNA Strand II (chains E) AGATGGACATTCG
>9YLM_3 DNA Strand I (chains F) GAATGTCCATCTC
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 3 |
Water and common crystallization additives (EDO) are not listed.
Regulation of BCL11A DNA binding and expression in human erythrocyte precursor HUDEP-2 cells. Yu, M., Das, P., Horton, J.R. et al. bioRxiv (2026). DOI 10.64898/2026.02.06.704516 · PubMed
Other PDB entries of the same protein (UniProt Q9H165 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9YLM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.