BCL11A ZF2-3 in Complex with a DNA Sequence Observed in the Human Globin Locus Containing Motif TGTCCA (C2221 Crystal Form). Determined by X-ray diffraction at 2.04 Å resolution. Released 4 Mar 2026.
Explore 9YLP in 3D Show helices and sheets RCSB PDB PDBe
9YLP contains 3 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 377-378 | 2 | 1 |
| β-strand | 385-386 | 2 | 1 |
| α-helix | 389-400 | 12 | |
| β-strand | 405-406 | 2 | 2 |
| β-strand | 413-414 | 2 | 2 |
| α-helix | 417-423 | 7 | |
| α-helix | 424-427 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| BCL11 transcription factor A | A | protein | 63 | Homo sapiens | Q9H165 (AlphaFold model) |
| DNA Strand II | D | DNA | 12 | Homo sapiens | |
| DNA Strand I | E | DNA | 12 | Homo sapiens |
>9YLP_1 BCL11 transcription factor A (chains A) HMPVKSKSCEFCGKTFKFQSNLVVHRRSHTGEKPYKCNLCDHACTQASKLKRHMKTHMHK SSP
>9YLP_2 DNA Strand II (chains D) AGATGGACATTC
>9YLP_3 DNA Strand I (chains E) GAATGTCCATCT
Water and common crystallization additives (PGE) are not listed.
Regulation of BCL11A DNA binding and expression in human erythrocyte precursor HUDEP-2 cells. Yu, M., Das, P., Horton, J.R. et al. bioRxiv (2026). DOI 10.64898/2026.02.06.704516 · PubMed
Other PDB entries of the same protein (UniProt Q9H165 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9YLP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.