9YP4: Human beta-cardiac myosin

Cryo-EM structure of human beta-cardiac myosin bound to omecamtiv mecarbil in the interacting-heads motif and S2-FH docked state. Determined by electron microscopy at 4.5 Å resolution. Released 8 Apr 2026.

Method: Electron microscopy
Resolution: 4.5 Å
Organisms: Homo sapiens, Saccharomyces cerevisiae, Aequorea victoria
Chains: 6
Atoms: 19,629
Mol. weight: 382.36 kDa
Ligands: 2OW, ADP, PO4
Released: 8 Apr 2026

Explore 9YP4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9YP4 contains 119 α-helices and 68 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 41 helices, 31 β-strands

Element	Residues	Length	Sheet
α-helix	7-15	9
α-helix	20-28	9
β-strand	36-40	5	1
β-strand	46-54	9	1
β-strand	58-62	5	1
β-strand	68-72	5	1
β-strand	78	1	1
α-helix	79-81	3
β-strand	89	1	2
α-helix	90-92	3
α-helix	98-109	12
β-strand	115-118	4	2
β-strand	121-125	5	2
α-helix	132-134	3
α-helix	136-140	5
α-helix	154-168	15
β-strand	171-176	6	2
α-helix	178-179	2
α-helix	184-200	17
α-helix	215-231	17
β-strand	233-235	3	3
β-strand	238-241	4	3
β-strand	246-249	4	2
β-strand	251-252	2	4
β-strand	258-260	3	4
β-strand	263-265	3	2
α-helix	271-273	3
β-strand	281	1	5
α-helix	284-290	7
α-helix	295-300	6
α-helix	307-309	3
α-helix	311-314	4
β-strand	317	1	5
α-helix	325-338	14
α-helix	343-359	17
β-strand	364-366	3	6
β-strand	373-375	3	6
α-helix	379-387	9
α-helix	392-400	9
β-strand	403-406	4	7
β-strand	409-412	4	7
α-helix	417-447	31
β-strand	457-460	4	2
β-strand	472	1	8
α-helix	473-490	18
α-helix	491-495	5
α-helix	496-503	8
α-helix	518-524	7
α-helix	530-537	8
α-helix	545-556	12
β-strand	563-564	2	9
β-strand	577-581	5	9
β-strand	584-588	5	9
β-strand	589	1	8
α-helix	593-598	6
α-helix	603-610	8
α-helix	615-620	6
α-helix	647-663	17
β-strand	665-673	9	2
α-helix	686-696	11
α-helix	698-706	9
β-strand	710-714	5	10
α-helix	715-721	7
α-helix	738-747	10
α-helix	753-755	3
β-strand	756-758	3	10
β-strand	762-765	4	10
α-helix	769-784	16
α-helix	786-823	38
α-helix	828-836	9
α-helix	837-839	3
α-helix	844-942	99

Chain B: 41 helices, 27 β-strands

Element	Residues	Length	Sheet
α-helix	5-7	3
α-helix	10-12	3
α-helix	13-16	4
α-helix	20-27	8
β-strand	36-40	5	11
β-strand	46-53	8	11
β-strand	58-63	6	11
β-strand	67-72	6	11
β-strand	77-78	2	11
α-helix	82-84	3
α-helix	98-110	13
β-strand	115-118	4	12
β-strand	121-125	5	12
α-helix	136-141	6
α-helix	154-168	15
β-strand	171-173	3	13
β-strand	175	1	14
β-strand	176-177	2	12
β-strand	179	1	15
α-helix	184-199	16
α-helix	215-231	17
β-strand	233	1	16
β-strand	241	1	16
β-strand	245-252	8	13
β-strand	258-266	9	13
α-helix	271-274	4
α-helix	284-290	7
α-helix	295-301	7
α-helix	307-309	3
α-helix	325-339	15
α-helix	343-358	16
α-helix	359-361	3
β-strand	363-366	4	17
β-strand	373-376	4	17
α-helix	379-388	10
α-helix	392-400	9
α-helix	417-447	31
α-helix	452-453	2
β-strand	455-457	3	13
β-strand	460	1	14
α-helix	462-464	3
β-strand	465	1	15
α-helix	473-490	18
α-helix	491-496	6
α-helix	497-503	7
α-helix	518-521	4
α-helix	530-539	10
α-helix	542	1
α-helix	545-556	12
β-strand	563-564	2	18
β-strand	577-581	5	18
β-strand	584-588	5	18
α-helix	593-598	6
α-helix	603-610	8
α-helix	615-624	10
α-helix	647-664	18
β-strand	665-667	3	13
β-strand	670-673	4	12
α-helix	686-696	11
α-helix	698-707	10
β-strand	711-714	4	19
α-helix	715-721	7
α-helix	722-725	4
α-helix	739-746	8
β-strand	762-765	4	19
α-helix	767-825	59
α-helix	828-833	6
α-helix	845-942	98

Chain C: 10 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	45-55	11
β-strand	64-65	2	20
α-helix	67-74	8
α-helix	82-89	8
α-helix	96-99	4
β-strand	101-102	2	20
α-helix	104-116	13
α-helix	123-131	9
β-strand	141-142	2	21
α-helix	143-148	6
α-helix	149-153	5
α-helix	159-166	8
β-strand	175-176	2	21
α-helix	178-186	9

Chain D: 10 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	43-56	14
β-strand	64	1	22
α-helix	66-68	3
α-helix	69-73	5
α-helix	82-88	7
α-helix	94-98	5
β-strand	102	1	22
α-helix	107-117	11
α-helix	123-130	8
β-strand	140-142	3	23
α-helix	143-152	10
α-helix	159-166	8
β-strand	175-177	3	23
α-helix	178-185	8

Chain E: 8 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	24-37	14
α-helix	49-55	7
α-helix	68-71	4
α-helix	83-90	8
α-helix	97-107	11
β-strand	115-116	2	24
α-helix	118-127	10
α-helix	133-139	7
β-strand	150-151	2	24
α-helix	153-161	9

Chain F: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	30-37	8
α-helix	49-53	5
α-helix	68-71	4
α-helix	81-89	9
α-helix	97-107	11
α-helix	117-125	9
α-helix	134-138	5
α-helix	139-141	3
α-helix	153-161	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Myosin-7,General control transcription factor GCN4,Enhanced Green fluorescent protein	A, B	protein	1315	Homo sapiens, Saccharomyces cerevisiae, Aequorea victoria	P03069 (AlphaFold model), P12883 (AlphaFold model), P42212 (AlphaFold model)
Myosin light chain 1/3, skeletal muscle isoform	C, D	protein	188	Mus musculus	P05977 (AlphaFold model)
Myosin regulatory light chain 11	E, F	protein	169	Mus musculus	P97457

Sequence of entity 1 (A, B), FASTA

>9YP4_1 Myosin-7,General control transcription factor GCN4,Enhanced Green fluorescent protein (chains A, B)
MGDSEMAVFGAAAPYLRKSEKERLEAQTRPFDLKKDVFVPDDKQEFVKAKIVSREGGKVT
AETEYGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKDRYGSWMIYTYSGL
FCVTVNPYKWLPVYTPEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGES
GAGKTVNTKRVIQYFAVIAAIGDRSKKDQSPGKGTLEDQIIQANPALEAFGNAKTVRNDN
SSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDM
LLITNNPYDYAFISQGETTVASIDDAEELMATDNAFDVLGFTSEEKNSMYKLTGAIMHFG
NMKFKLKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQV
IYATGALAKAVYERMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINF
TNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMF
PKATDMTFKAKLFDNHLGKSANFQKPRNIKGKPEAHFSLIHYAGIVDYNIIGWLQKNKDP
LNETVVGLYQKSSLKLLSTLFANYAGADAPIEKGKGKAKKGSSFQTVSALHRENLNKLMT
NLRSTHPHFVRCIIPNETKSPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQ
RYRILNPAAIPEGQFIDSRKGAEKLLSSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDER
LSRIITRIQAQSRGVLARMEYKKLLERRDSLLVIQWNIRAFMGVKNWPWMKLYFKIKPLL
KSAEREKEMASMKEEFTRLKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLAD
AEERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELT
LAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKMKQL
EDKVEELLSKNYHLENEVARLKKLVGERGSGKLGVSKGEELFTGVVPILVELDGDVNGHK
FSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKS
AMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYN
SHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSA
LSKDPNEKRDHMVLLEFVTAAGITLGMDELYKGLNDIFEAQKIEWHEDYKDDDDK

Sequence of entity 2 (C, D), FASTA

>9YP4_2 Myosin light chain 1/3, skeletal muscle isoform (chains C, D)
MAPKKDVKKPAAAPAPAPAPAPAPAKPKEEKIDLSAIKIEFSKEQQEDFKEAFLLFDRTG
ECKITLSQVGDVLRALGTNPTNAEVKKVLGNPSNEEMNAKKIEFEQFLPMMQAISNNKDQ
GGYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMKEEEVEALLAGQEDSNGCINYEA
FVKHIMSV

Sequence of entity 3 (E, F), FASTA

>9YP4_3 Myosin regulatory light chain 11 (chains E, F)
MAPKKAKRRAGAEGSSNVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRL
NVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKQFL
EELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE

Ligands and cofactors

ID	Name	Formula	Copies
2OW	methyl 4-(2-fluoro-3-{[(6-methylpyridin-3-yl)carbamoyl]amino}benzyl)piperazine-…	C20 H24 F N5 O3	2
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	2
PO4	Phosphate ion	O4 P	2

Primary citation

Cryo-EM reveals how cardiomyopathy therapeutic drugs modulate the myosin motors of the heart. Somavarapu, A.K., Ge, J., Yengo, C.M. et al. Sci Adv (2026) 12:eaed6472-eaed6472. DOI 10.1126/sciadv.aed6472 · PubMed

Other PDB entries of the same protein (UniProt P03069 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3AZD 0.98 Å, Crystal structure of tropomyosin N-terminal fragment at 0.98A resolution
2WQ1 1.08 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating bromide
2WQ0 1.12 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating chloride
4OWI 1.2 Å, peptide structure
2WQ3 1.22 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating chloride and nitrate
2HY6 1.25 Å, A seven-helix coiled coil
2WPZ 1.25 Å, GCN4 leucine zipper mutant with two VxxNxxx motifs coordinating chloride
6PSA 1.3 Å, PIE12 D-peptide against HIV entry (in complex with IQN17 Q577R resistance mutant)
2IPZ 1.35 Å, A Parallel Coiled-Coil Tetramer with Offset Helices
2YNY 1.35 Å, Salmonella enterica SadA 255-302 fused to GCN4 adaptors (SadAK1)
5APU 1.35 Å, Sequence IANKEDKAD inserted between GCN4 adaptors - Structure A9b black
2WQ2 1.36 Å, GCN4 leucine zipper mutant with three IxxNTxx motifs coordinating iodide

Browse structure collections

About this viewer

MolViewer shows 9YP4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.