9YXD: Recombinant human follicle stimulating hormone

Name: PDB 9YXD: Crystal structure of recombinant human follicle stimulating hormone in complex with an anti-FSH alpha Fab
Published: 2026-03-11
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: hormone

Crystal structure of recombinant human follicle stimulating hormone in complex with an anti-FSH alpha Fab. Determined by X-ray diffraction at 2.29 Å resolution. Released 11 Mar 2026.

Method: X-ray diffraction
Resolution: 2.29 Å
Organisms: Homo sapiens, Mus musculus, Lama glama
Chains: 5
Atoms: 6,119
Mol. weight: 86.75 kDa
Ligands: BTB, NAG
Released: 11 Mar 2026

Explore 9YXD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9YXD contains 32 α-helices and 71 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	8	1
β-strand	9	1	1
α-helix	10	1
β-strand	11-14	4	1
α-helix	16-18	3
β-strand	20	1	2
β-strand	23	1	2
α-helix	24-25	2
β-strand	26-38	13	1
α-helix	39-40	2
α-helix	41-44	4
β-strand	53-57	5	1
β-strand	59-70	12	3
β-strand	74-85	12	3

Chain B: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	4-14	11	1
α-helix	15-17	3
β-strand	19-35	17	1
α-helix	47-48	2
β-strand	49-63	15	4
β-strand	66	1	5
β-strand	69	1	5
β-strand	72-86	15	4
β-strand	92-95	4	1

Chain C: 9 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	6
β-strand	10-14	5	7
β-strand	19-25	7	6
α-helix	26-27	2
β-strand	35-42	8	7
β-strand	49-53	5	7
β-strand	57-58	2	7
α-helix	59	1
β-strand	66-70	5	6
β-strand	74-79	6	6
α-helix	84-86	3
β-strand	88-96	9	7
β-strand	101-104	4	7
β-strand	108-113	6	7
β-strand	117	1	8
α-helix	118-119	2
β-strand	120-124	5	9
α-helix	125-127	3
α-helix	128-132	5
β-strand	135-145	11	9
β-strand	146	1	8
β-strand	150-156	7	10
β-strand	159-160	2	10
α-helix	161	1
β-strand	165-169	5	9
α-helix	170-173	4
β-strand	179-188	10	9
α-helix	189-193	5
β-strand	197-204	8	10
β-strand	211-216	6	10

Chain D: 10 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	11
α-helix	7-9	3
β-strand	10-12	3	12
β-strand	18-24	7	11
α-helix	29-31	3
β-strand	34-39	6	12
β-strand	45-51	7	12
β-strand	58-60	3	12
α-helix	62-64	3
β-strand	68-73	6	11
β-strand	78-83	6	11
α-helix	88-90	3
β-strand	92-100	9	12
β-strand	103-107	5	12
β-strand	111-115	5	12
β-strand	121	1	13
α-helix	122-123	2
β-strand	124-128	5	14
α-helix	132-134	3
β-strand	135-136	2	14
β-strand	139-149	11	14
β-strand	150	1	13
β-strand	155-158	4	15
α-helix	159-161	3
β-strand	163	1	15
β-strand	167-169	3	14
α-helix	170-172	3
β-strand	173-174	2	14
β-strand	180-189	10	14
α-helix	190-192	3
β-strand	199-204	6	15
α-helix	205-207	3
β-strand	209-214	6	15

Chain K: 5 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	16
β-strand	10-12	3	17
β-strand	18-25	8	16
α-helix	29-31	3
β-strand	34-39	6	17
α-helix	44-45	2
β-strand	46-51	6	17
β-strand	58-60	3	17
α-helix	62-64	3
β-strand	68-73	6	16
α-helix	74-76	3
β-strand	78-83	6	16
α-helix	88-90	3
β-strand	92-98	7	17
β-strand	110-111	2	17
β-strand	112	1	16
β-strand	115-119	5	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glycoprotein hormones alpha chain	A	protein	92	Homo sapiens	P01215 (AlphaFold model)
Follitropin subunit beta	B	protein	111	Homo sapiens	P01225 (AlphaFold model)
Fab light chain	C	protein	220	Mus musculus
Fab heavy chain	D	protein	225	Mus musculus
Ig-like domain-containing protein	K	protein	127	Lama glama

Sequence of entity 1 (A), FASTA

>9YXD_1 Glycoprotein hormones alpha chain (chains A)
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC
VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS

Sequence of entity 2 (B), FASTA

>9YXD_2 Follitropin subunit beta (chains B)
NSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDPARPKIQKTCTFKELVYET
VRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPSYCSFGEMKE

Sequence of entity 3 (C), FASTA

>9YXD_3 Fab light chain (chains C)
DIELTQSPDSLSVSLGQRATISCRASESVDSYGNSFMQWYQQKPGQPPKLLIYRASNLES
GIPARFSGTGSRTDFTLTINPVEADDVATYYCQQSDEYPYMYTFGGGTKLEIKRTVAAPS
VFIFPPSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYS
LSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 4 (D), FASTA

>9YXD_4 Fab heavy chain (chains D)
QVQLQQSGAELVKPGASVKLSCKASDYTFTSYWMHWVKQRPGQGLEWIGEINPTNGRTYY
NEKFKSKATLTVDKSSSTAYMQLSSLTSEDSAVYYCARRYGNSFDYWGQGTTVTVSSAST
KGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY
SLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHT

Sequence of entity 5 (K), FASTA

>9YXD_5 Ig-like domain-containing protein (chains K)
HHHHHHQVQLQESGGGLVQPGGSLRLSCAASGRTISRYAMSWFRQAPGKEREFVAVARRS
GDGAFYADSVQGRFTVSRDDAKNTVYLQMNSLKPEDTAVYYCAIDSDTFYSGSYDYWGQG
TQVTVSS

Ligands and cofactors

ID	Name	Formula	Copies
BTB	2-[bis-(2-hydroxy-ethyl)-amino]-2-hydroxymethyl-propane-1,3-diol	C8 H19 N O5	1
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3

Water and common crystallization additives (GOL) are not listed.

Primary citation

Disulfide Bond Mapping of Follitropin Delta, a Recombinant Follicle Stimulating Hormone (rFSH), by X-Ray Crystallography. Kalson, D., Joseph, J.S., Nudelman, H. et al. Pharmaceuticals (Basel) (2026) 19. DOI 10.3390/ph19030380 · PubMed

Other PDB entries of the same protein (UniProt P01215 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7UTZ 2.4 Å, Human thyrotropin analog TR1402 bound to human Thyrotropin receptor in complex with…
4AY9 2.5 Å, Structure of follicle-stimulating hormone in complex with the entire ectodomain of its…
1HCN 2.6 Å, Structure of human chorionic gonadotropin at 2.6 Å resolution from mad analysis of the…
8I2G 2.8 Å, FSHR-Follicle stimulating hormone-compound 716340-Gs complex
4MQW 2.9 Å, Structure of follicle-stimulating hormone in complex with the entire ectodomain of its…
7T9I 2.9 Å, Native human TSH bound to human Thyrotropin receptor in complex with miniGs399…
1XWD 2.92 Å, Crystal Structure of Human Follicle Stimulating Hormone Complexed with its Receptor
7XW5 2.96 Å, TSHR-thyroid stimulating hormone-Gs-ML109 complex
1FL7 3.0 Å, Human follicle stimulating hormone
1HRP 3.0 Å, Crystal structure of human chorionic gonadotropin
7FIH 3.2 Å, luteinizing hormone/choriogonadotropin receptor(S277I)-chorionic…
1QFW 3.5 Å, Ternary complex of human chorionic gonadotropin with fv anti alpha subunit and fv anti…

Browse structure collections

About this viewer

MolViewer shows 9YXD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.