9ZB7: Transcription factor ETV6,DARPin

Name: PDB 9ZB7: A DARPin fused to the 1TEL crystallization chaperone via a direct helical fusion
Published: 2025-12-17
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

A DARPin fused to the 1TEL crystallization chaperone via a direct helical fusion. Determined by X-ray diffraction at 1.24 Å resolution. Released 17 Dec 2025.

Method: X-ray diffraction
Resolution: 1.24 Å
Organisms: Homo sapiens, synthetic construct
Chains: 1
Atoms: 2,105
Mol. weight: 28.29 kDa
Ligands: AKG, PO4, EOH
Released: 17 Dec 2025

Explore 9ZB7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9ZB7 contains 18 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 0 β-strands

Element	Residues	Length
α-helix	9-10	2
α-helix	18-20	3
α-helix	24-26	3
α-helix	29-42	14
α-helix	45-47	3
α-helix	50-52	3
α-helix	57-60	4
α-helix	65-71	7
α-helix	76-98	23
α-helix	101-109	9
α-helix	124-130	7
α-helix	134-142	9
α-helix	157-164	8
α-helix	167-175	9
α-helix	190-196	7
α-helix	200-208	9
α-helix	223-229	7
α-helix	233-240	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor ETV6,DARPin	A	protein	243	Homo sapiens, synthetic construct	P41212 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9ZB7_1 Transcription factor ETV6,DARPin (chains A)
MGHHHHHHHHHHSIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKAL
LLLTKEDFRYRSPHSGDELYELLQHILLGRDLLEAARAGQDDEVRILMANGADVNATDND
GYTPLHLAASNGHLEIVEVLLKNGADVNASDLTGITPLHAAAATGHLEIVEVLLKHGADV
NAYDNDGHTPLHLAAKYGHLEIVEVLLKHGADVNAQDKFGKTAFDISIDNGNEDLAEILQ
KLN

Ligands and cofactors

ID	Name	Formula	Copies
AKG	2-oxoglutaric acid	C5 H6 O5	1
PO4	Phosphate ion	O4 P	4
EOH	Ethanol	C2 H6 O	2

Water and common crystallization additives (NH4, GOL, CL, K) are not listed.

Primary citation

Polymer crystallization physics discovered through modulating the pH sensitivity of the TELSAM crystallization chaperone for increased solubility. Averett, J.C., Bradford, M.J., Wilson, E.W. et al. To be published.

Other PDB entries of the same protein (UniProt P41212 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9DOC 1.19 Å, The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly…
9Q4D 1.3 Å, A DARPin fused to the double trigger 1TEL variant crystallization chaperone via a direct…
7TW9 1.41 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to Sinefungin
1JI7 1.45 Å, Crystal Structure of TEL SAM Polymer
7TDY 1.53 Å, The ubiquitin-associated domain of human thirty-eight negative kinase 1, flexibly fused…
7TW8 1.55 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SAH
8FRJ 1.57 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SGC0946
9DB5 1.57 Å, A DARPin fused to the 1TEL crystallization chaperone via a proline-alanine linker
8FT8 1.6 Å, The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly…
8FRK 1.61 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SGC8158
7TW7 1.62 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SAM
8THA 1.68 Å, 1TEL, non-compressed, double-helical crystal form

Browse structure collections

About this viewer

MolViewer shows 9ZB7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.