9ZMZ: COMM domain-containing protein 4

Crystal structure of the human Commd4 HN domain in a domain swapped conformation. Determined by X-ray diffraction at 2.12 Å resolution. Released 21 Jan 2026.

Method: X-ray diffraction
Resolution: 2.12 Å
Organism: Homo sapiens
Chains: 1
Atoms: 764
Mol. weight: 12.27 kDa
Released: 21 Jan 2026

Explore 9ZMZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9ZMZ contains 6 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 0 β-strands

Element	Residues	Length
α-helix	14-23	10
α-helix	27-43	17
α-helix	49-56	8
α-helix	62-78	17
α-helix	86-95	10
α-helix	100-112	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
COMM domain-containing protein 4	A	protein	112	Homo sapiens	Q9H0A8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9ZMZ_1 COMM domain-containing protein 4 (chains A)
SPDWVLAEISTLAKMSSVKLRLLCSQVLKELLGQGIDYEKILKLTADAKFESGDVKATVA
VLSFILSSAAKHSVDGESLSSELQQLGLPKEHAASLCRCYEEKQSPLQKHLR

Primary citation

A remarkable case of conserved domain swapping in the COMMD family of proteins. Collins, B.M., Healy, M.D., Liu, M. et al. To be published.

Other PDB entries of the same protein (UniProt Q9H0A8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8P0W 2.9 Å, Structure of the human Commander complex COMMD ring
8F2R 3.12 Å, Human CCC complex
8F2U 3.53 Å, Human CCC complex

Browse structure collections

About this viewer

MolViewer shows 9ZMZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.