9ZNB: PDB entry 9ZNB

Crystal Structure of a DARPin Fused to the 1TEL Crystallization Chaperone via a Direct Helical Fusion in a 3-Fold Crystal Form. Determined by X-ray diffraction at 1.77 Å resolution. Released 14 Jan 2026.

Method: X-ray diffraction
Resolution: 1.77 Å
Organisms: Homo sapiens, synthetic construct
Chains: 1
Atoms: 1,912
Mol. weight: 27.36 kDa
Ligands: MG
Released: 14 Jan 2026

Explore 9ZNB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9ZNB contains 16 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 0 β-strands

Element	Residues	Length
α-helix	17-19	3
α-helix	23-25	3
α-helix	28-41	14
α-helix	44-46	3
α-helix	56-59	4
α-helix	64-70	7
α-helix	75-97	23
α-helix	100-108	9
α-helix	123-129	7
α-helix	133-141	9
α-helix	156-163	8
α-helix	166-174	9
α-helix	189-195	7
α-helix	199-207	9
α-helix	222-228	7
α-helix	232-240	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor ETV6,SAM Domain of Transcription factor ETV6 fused to a DARPin	A	protein	243	Homo sapiens, synthetic construct	P41212 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9ZNB_1 Transcription factor ETV6,SAM Domain of Transcription factor ETV6 fused to a DARPin (chains A)
MGHHHHHHHHHHSIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKAL
LLLTKEDFRYRSPHSGDELYELLQHILLGRDLLEAARAGQDDEVRILMANGADVNATDND
GYTPLHLAASNGHLEIVEVLLKNGADVNASDLTGITPLHAAAATGHLEIVEVLLKHGADV
NAYDNDGHTPLHLAAKYGHLEIVEVLLKHGADVNAQDKFGKTAFDISIDNGNEDLAEILQ
KKN

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2

Water and common crystallization additives (CL, ACY) are not listed.

Primary citation

Optimal 1TEL-target protein linker character is target protein-dependent. Pedroza Romo, M.J., Keliiliki, A., Averett, J.C. et al. Acta Crystallogr D Struct Biol (2026) 82:516-532. DOI 10.1107/S2059798326002494 · PubMed

Other PDB entries of the same protein (UniProt P41212 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9DOC 1.19 Å, The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly…
9ZB7 1.24 Å, A DARPin fused to the 1TEL crystallization chaperone via a direct helical fusion
9Q4D 1.3 Å, A DARPin fused to the double trigger 1TEL variant crystallization chaperone via a direct…
7TW9 1.41 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to Sinefungin
1JI7 1.45 Å, Crystal Structure of TEL SAM Polymer
7TDY 1.53 Å, The ubiquitin-associated domain of human thirty-eight negative kinase 1, flexibly fused…
7TW8 1.55 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SAH
8FRJ 1.57 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SGC0946
9DB5 1.57 Å, A DARPin fused to the 1TEL crystallization chaperone via a proline-alanine linker
8FT8 1.6 Å, The von Willebrand factor A domain of human capillary morphogenesis gene II, flexibly…
8FRK 1.61 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SGC8158
7TW7 1.62 Å, Structure of nsp14 N7-MethylTransferase domain fused with TELSAM bound to SAM

Browse structure collections

About this viewer

MolViewer shows 9ZNB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.