9ZZV: Orthogonal T-cell receptor alpha constant domain

Human T-cell receptor (TCR) with computationally designed orthogonal interface. Determined by X-ray diffraction at 2.05 Å resolution. Released 28 Jan 2026.

Method: X-ray diffraction
Resolution: 2.05 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,634
Mol. weight: 26.82 kDa
Released: 28 Jan 2026

Explore 9ZZV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9ZZV contains 6 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	126-131	6	1
β-strand	132	1	2
β-strand	139-146	8	1
α-helix	150-155	6
β-strand	160-162	3	1
α-helix	163-165	3
β-strand	166-168	3	1
β-strand	177-184	8	1
β-strand	205	1	1

Chain B: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	123	1	3
α-helix	124-125	2
β-strand	126-130	5	2
α-helix	131-133	3
α-helix	134-140	7
β-strand	142-152	11	2
β-strand	153	1	3
β-strand	157-163	7	4
β-strand	166-168	3	4
β-strand	172-174	3	2
β-strand	179-180	2	2
β-strand	190-199	10	2
α-helix	200-203	4
β-strand	209-216	8	4
β-strand	235-242	8	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Orthogonal T-cell receptor alpha constant domain (combiC26a)	A	protein	106	Homo sapiens	P01848 (AlphaFold model)
Orthogonal T-cell receptor beta constant domain (combiC26b)	B	protein	131	Homo sapiens	A0A5B9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9ZZV_1 Orthogonal T-cell receptor alpha constant domain (combiC26a) (chains A)
HHHHHHHHGSPYIQNPQPAVYQLRDSKSSDKFVCLFTHFDSQIAVSQSKDSDVYITDKCV
LDMRSMDRKKNRAVAWSAKSDFTCANAFANSIIPEDTKFPSPESSC

Sequence of entity 2 (B), FASTA

>9ZZV_2 Orthogonal T-cell receptor beta constant domain (combiC26b) (chains B)
EDLKNVFPPEVAVFEPSKAEISLTQEATLVCLATGFYPPHVELSWWVNGKEVHDGVCTDP
QPLKEQPALADSRYALSSTLSVSATFWQDPRNHFRCQVQFYGLSENDEWTQDRAKPVTQI
VSAEAWGRADC

Primary citation

Computational design of orthogonal TCR alpha beta interfaces for dual TCR therapeutics. Kinjo, T., Yu, S., Nicely, N.I. et al. To be published.

Other PDB entries of the same protein (UniProt P01848 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4UDT 1.35 Å, T cell receptor (TRAV22,TRBV7-9) structure
4WW1 1.38 Å, Crystal structure of human TCR Alpha Chain-TRAV21-TRAJ8 and Beta Chain-TRBV7-8
1OGA 1.4 Å, A structural basis for immunodominant human T-cell receptor recognition.
2BNU 1.4 Å, Structural and kinetic basis for heightened immunogenicity of T cell vaccines
1KGC 1.5 Å, Immune Receptor
2BNQ 1.7 Å, Structural and kinetic basis for heightened immunogenicity of T cell vaccines
2BNR 1.9 Å, Structural and kinetic basis for heightened immunogenicity of T cell vaccines
2IAL 1.92 Å, Structural basis for recognition of mutant self by a tumor-specific, MHC class…
5C0C 1.97 Å, 1E6 TCR in complex with HLA-A02 carrying RQFGPDWIVA
2VLM 1.98 Å, The Structural Dynamics and Energetics of an Immunodominant T-cell Receptor are…
5KSA 2.0 Å, Bel602-DQ8.5-glia-gamma1 complex
7RYL 2.0 Å, T cell receptor CO3

Browse structure collections

About this viewer

MolViewer shows 9ZZV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.