Dsnr (ZIF268 variant) zinc finger-DNA complex (gcgt site). Determined by X-ray diffraction at 1.9 Å resolution. Released 10 Jun 1998.
Explore 1A1G in 3D Show helices and sheets RCSB PDB PDBe
1A1G contains 4 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 106 | 1 | 1 |
| β-strand | 115 | 1 | 1 |
| α-helix | 121-130 | 10 | |
| β-strand | 135-136 | 2 | 2 |
| β-strand | 143-144 | 2 | 2 |
| α-helix | 147-158 | 12 | |
| β-strand | 163-164 | 2 | 3 |
| β-strand | 171-172 | 2 | 3 |
| α-helix | 175-182 | 8 | |
| α-helix | 183-185 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| DNA (5'-d(*ap*gp*cp*gp*tp*gp*gp*gp*cp*gp*t)-3') | B | DNA | 11 | ||
| DNA (5'-d(*tp*ap*cp*gp*cp*cp*cp*ap*cp*gp*c)-3') | C | DNA | 11 | ||
| Dsnr zinc finger peptide | A | protein | 90 | Mus musculus | P08046 (AlphaFold model) |
>1A1G_1 DNA (5'-D(*AP*GP*CP*GP*TP*GP*GP*GP*CP*GP*T)-3') (chains B) AGCGTGGGCGT
>1A1G_2 DNA (5'-D(*TP*AP*CP*GP*CP*CP*CP*AP*CP*GP*C)-3') (chains C) TACGCCCACGC
>1A1G_3 DSNR ZINC FINGER PEPTIDE (chains A) MERPYACPVESCDRRFSDSSNLTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGE KPFACDICGRKFARSDERKRHTKIHLRQKD
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 3 |
High-resolution structures of variant Zif268-DNA complexes: implications for understanding zinc finger-DNA recognition. Elrod-Erickson, M., Benson, T.E., Pabo, C.O. Structure (1998) 6:451-464. DOI 10.1016/S0969-2126(98)00047-1 · PubMed
Other PDB entries of the same protein (UniProt P08046 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1A1G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.