Crystal structure of iia mannitol from escherichia coli. Determined by X-ray diffraction at 1.8 Å resolution. Released 12 Aug 1998.
Explore 1A3A in 3D Show helices and sheets RCSB PDB PDBe
1A3A contains 30 α-helices and 31 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-11 | 3 | |
| β-strand | 12-13 | 2 | 1 |
| α-helix | 21-34 | 14 | |
| β-strand | 38 | 1 | 2 |
| α-helix | 41-52 | 12 | |
| β-strand | 56-58 | 3 | 1 |
| β-strand | 61-62 | 2 | 1 |
| β-strand | 65 | 1 | 1 |
| α-helix | 68-73 | 6 | |
| β-strand | 74 | 1 | 2 |
| β-strand | 78-89 | 12 | 1 |
| β-strand | 97-105 | 9 | 1 |
| α-helix | 111-121 | 11 | |
| α-helix | 125-133 | 9 | |
| α-helix | 137-143 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-11 | 3 | |
| β-strand | 12-13 | 2 | 3 |
| α-helix | 21-34 | 14 | |
| β-strand | 38 | 1 | 4 |
| α-helix | 41-52 | 12 | |
| β-strand | 56-58 | 3 | 3 |
| β-strand | 61-62 | 2 | 3 |
| β-strand | 65 | 1 | 3 |
| α-helix | 68-73 | 6 | |
| β-strand | 74 | 1 | 4 |
| β-strand | 78-89 | 12 | 3 |
| β-strand | 97-105 | 9 | 3 |
| α-helix | 111-121 | 11 | |
| α-helix | 125-133 | 9 | |
| α-helix | 137-144 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-11 | 3 | |
| β-strand | 12-13 | 2 | 5 |
| α-helix | 21-34 | 14 | |
| β-strand | 38 | 1 | 6 |
| α-helix | 41-52 | 12 | |
| β-strand | 56-58 | 3 | 5 |
| β-strand | 61-62 | 2 | 5 |
| α-helix | 68-73 | 6 | |
| β-strand | 74 | 1 | 6 |
| β-strand | 78-89 | 12 | 5 |
| β-strand | 97-105 | 9 | 5 |
| α-helix | 107-109 | 3 | |
| α-helix | 111-121 | 11 | |
| α-helix | 125-133 | 9 | |
| α-helix | 137-144 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-11 | 3 | |
| β-strand | 12-13 | 2 | 7 |
| α-helix | 21-34 | 14 | |
| β-strand | 38 | 1 | 8 |
| α-helix | 41-52 | 12 | |
| β-strand | 56 | 1 | 7 |
| β-strand | 61-62 | 2 | 7 |
| β-strand | 65 | 1 | 7 |
| α-helix | 68-73 | 6 | |
| β-strand | 74 | 1 | 8 |
| β-strand | 78-89 | 12 | 7 |
| β-strand | 97-105 | 9 | 7 |
| α-helix | 107-109 | 3 | |
| α-helix | 111-121 | 11 | |
| α-helix | 125-133 | 9 | |
| α-helix | 137-144 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Mannitol-specific eii | A, B, C, D | protein | 148 | Escherichia coli | P00550 (AlphaFold model) |
>1A3A_1 MANNITOL-SPECIFIC EII (chains A, B, C, D) MANLFKLGAENIFLGRKAATKEEAIRFAGEQLVKGGYVEPEYVQAMLDREKLTPTYLGES IAVPHGTVEAKDRVLKTGVVFCQYPEGVRFGEEEDDIARLVIGIAARNNEHIQVITSLTN ALDDESVIERLAHTTSVDEVLELLAGRK
The structure of the Escherichia coli phosphotransferase IIAmannitol reveals a novel fold with two conformations of the active site. van Montfort, R.L., Pijning, T., Kalk, K.H. et al. Structure (1998) 6:377-388. DOI 10.1016/S0969-2126(98)00039-2 · PubMed
Other PDB entries of the same protein (UniProt P00550 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1A3A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.