1A3A: Iia mannitol from escherichia coli

Name: PDB 1A3A: Crystal structure of iia mannitol from escherichia coli
Published: 1998-08-12
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: phosphotransferase

Crystal structure of iia mannitol from escherichia coli. Determined by X-ray diffraction at 1.8 Å resolution. Released 12 Aug 1998.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Escherichia coli
Chains: 4
Atoms: 5,041
Mol. weight: 65.39 kDa
Released: 12 Aug 1998

Explore 1A3A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1A3A contains 30 α-helices and 31 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	9-11	3
β-strand	12-13	2	1
α-helix	21-34	14
β-strand	38	1	2
α-helix	41-52	12
β-strand	56-58	3	1
β-strand	61-62	2	1
β-strand	65	1	1
α-helix	68-73	6
β-strand	74	1	2
β-strand	78-89	12	1
β-strand	97-105	9	1
α-helix	111-121	11
α-helix	125-133	9
α-helix	137-143	7

Chain B: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	9-11	3
β-strand	12-13	2	3
α-helix	21-34	14
β-strand	38	1	4
α-helix	41-52	12
β-strand	56-58	3	3
β-strand	61-62	2	3
β-strand	65	1	3
α-helix	68-73	6
β-strand	74	1	4
β-strand	78-89	12	3
β-strand	97-105	9	3
α-helix	111-121	11
α-helix	125-133	9
α-helix	137-144	8

Chain C: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	9-11	3
β-strand	12-13	2	5
α-helix	21-34	14
β-strand	38	1	6
α-helix	41-52	12
β-strand	56-58	3	5
β-strand	61-62	2	5
α-helix	68-73	6
β-strand	74	1	6
β-strand	78-89	12	5
β-strand	97-105	9	5
α-helix	107-109	3
α-helix	111-121	11
α-helix	125-133	9
α-helix	137-144	8

Chain D: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	9-11	3
β-strand	12-13	2	7
α-helix	21-34	14
β-strand	38	1	8
α-helix	41-52	12
β-strand	56	1	7
β-strand	61-62	2	7
β-strand	65	1	7
α-helix	68-73	6
β-strand	74	1	8
β-strand	78-89	12	7
β-strand	97-105	9	7
α-helix	107-109	3
α-helix	111-121	11
α-helix	125-133	9
α-helix	137-144	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mannitol-specific eii	A, B, C, D	protein	148	Escherichia coli	P00550 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1A3A_1 MANNITOL-SPECIFIC EII (chains A, B, C, D)
MANLFKLGAENIFLGRKAATKEEAIRFAGEQLVKGGYVEPEYVQAMLDREKLTPTYLGES
IAVPHGTVEAKDRVLKTGVVFCQYPEGVRFGEEEDDIARLVIGIAARNNEHIQVITSLTN
ALDDESVIERLAHTTSVDEVLELLAGRK

Primary citation

The structure of the Escherichia coli phosphotransferase IIAmannitol reveals a novel fold with two conformations of the active site. van Montfort, R.L., Pijning, T., Kalk, K.H. et al. Structure (1998) 6:377-388. DOI 10.1016/S0969-2126(98)00039-2 · PubMed

Other PDB entries of the same protein (UniProt P00550 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1J6T Complex of enzyme iiamtl and the histidine-containing phosphocarrier protein hpr from…
1VKR Structure of iib domain of the mannitol-specific permease enzyme II
1VRV Structure of phosphorylated IIB (C384(SEP)) domain of the mannitol-specific permease…
2FEW Complex of enzyme IIAMTL and phosphorylated enzyme IIBMTL from Escherichia coli NMR,…
9A2W Model of E. coli MtlA by in-cell photo-crosslinking MS and deep learning

Browse structure collections

About this viewer

MolViewer shows 1A3A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.