1VRV: PDB entry 1VRV

Name: PDB 1VRV: Structure of phosphorylated IIB (C384(SEP)) domain of the mannitol-specific permease enzyme II
Published: 2005-11-22
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

Structure of phosphorylated IIB (C384(SEP)) domain of the mannitol-specific permease enzyme II. Determined by solution NMR. Released 22 Nov 2005.

Method: Solution NMR
Organism: Escherichia coli
Chains: 1
Atoms: 736
Mol. weight: 11.03 kDa
Released: 22 Nov 2005

Explore 1VRV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1VRV contains 3 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	379-384	6	1
α-helix	390-404	15
β-strand	411-416	6	1
β-strand	426-430	5	1
α-helix	431-440	10
β-strand	445-449	5	1
α-helix	455-470	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
mannitol-specific PTS system enzyme IIABC components	A	protein	101	Escherichia coli	P00550 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1VRV_1 mannitol-specific PTS system enzyme IIABC components (chains A)
SHVRKIIVASDAGMGSSAMGAGVLRKKIQDAGLSQISVTNSAINNLPPDVDLVITHRDLT
ERAMRQVPQAQHISLTNFLDSGLYTSLTERLVAAQRHTENE

Primary citation

Visualization of the Phosphorylated Active Site Loop of the Cytoplasmic B Domain of the Mannitol Transporter II(Mannitol) of the Escherichia coli Phosphotransferase System by NMR Spectroscopy and Residual Dipolar Couplings. Suh, J.Y., Tang, C., Cai, M. et al. J Mol Biol (2005) 353:1129-1136. DOI 10.1016/j.jmb.2005.09.033 · PubMed

Other PDB entries of the same protein (UniProt P00550 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1A3A 1.8 Å, Crystal structure of iia mannitol from escherichia coli
1J6T Complex of enzyme iiamtl and the histidine-containing phosphocarrier protein hpr from…
1VKR Structure of iib domain of the mannitol-specific permease enzyme II
2FEW Complex of enzyme IIAMTL and phosphorylated enzyme IIBMTL from Escherichia coli NMR,…
9A2W Model of E. coli MtlA by in-cell photo-crosslinking MS and deep learning

Browse structure collections

About this viewer

MolViewer shows 1VRV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.