1J6T: Pts system, mannitol-specific iiabc component

Name: PDB 1J6T: Complex of enzyme iiamtl and the histidine-containing phosphocarrier protein hpr from escherichia coli NMR, restrained regularized mean structure
Published: 2002-11-13
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

Complex of enzyme iiamtl and the histidine-containing phosphocarrier protein hpr from escherichia coli NMR, restrained regularized mean structure. Determined by solution NMR. Released 13 Nov 2002.

Method: Solution NMR
Organism: Escherichia coli
Chains: 2
Atoms: 1,774
Mol. weight: 25.56 kDa
Ligands: PO3
Released: 13 Nov 2002

Explore 1J6T in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1J6T contains 11 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	9-11	3
β-strand	12-13	2	1
α-helix	21-34	14
β-strand	38	1	2
α-helix	41-52	12
β-strand	56	1	1
β-strand	61-62	2	1
α-helix	68-73	6
β-strand	74	1	2
β-strand	78-89	12	1
β-strand	97-105	9	1
α-helix	107-109	3
α-helix	111-121	11
α-helix	125-133	9
α-helix	137-144	8

Chain B: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	302-307	6	3
α-helix	316-327	12
β-strand	332-337	6	3
β-strand	340-343	4	3
α-helix	347-350	4
β-strand	360-366	7	3
α-helix	370-383	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Pts system, mannitol-specific iiabc component	A	protein	148	Escherichia coli	P00550 (AlphaFold model)
Phosphocarrier protein HPr	B	protein	85	Escherichia coli	P0AA04 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1J6T_1 PTS SYSTEM, MANNITOL-SPECIFIC IIABC COMPONENT (chains A)
MANLFKLGAENIFLGRKAATKEEAIRFAGEQLVKGGYVEPEYVQAMLDREKLTPTYLGES
IAVPHGTVEAKDRVLKTGVVFCQYPEGVRFGEEEDDIARLVIGIAARNNEHIQVITSLTN
ALDDESVIERLAHTTSVDEVLELLAGRK

Sequence of entity 2 (B), FASTA

>1J6T_2 Phosphocarrier protein HPr (chains B)
MFQQEVTITAPNGLHTRPAAQFVKEAKGFTSEITVTSNGKSASAKSLFKLQTLGLTQGTV
VTISAEGEDEQKAVEHLVKLMAELE

Ligands and cofactors

ID	Name	Formula	Copies
PO3	Phosphite ion	O3 P	1

Primary citation

Solution Structure of the Phosphoryl Transfer Complex between the Cytoplasmic A Domain of the Mannitol Transporter IImannitol and HPr of the Escherichia coli Phosphotransferase System. Cornilescu, G., Lee, B.R., Cornilescu, C.C. et al. J Biol Chem (2002) 277:42289-42298. DOI 10.1074/jbc.M207314200 · PubMed

Other PDB entries of the same protein (UniProt P00550 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1A3A 1.8 Å, Crystal structure of iia mannitol from escherichia coli
1VKR Structure of iib domain of the mannitol-specific permease enzyme II
1VRV Structure of phosphorylated IIB (C384(SEP)) domain of the mannitol-specific permease…
2FEW Complex of enzyme IIAMTL and phosphorylated enzyme IIBMTL from Escherichia coli NMR,…
9A2W Model of E. coli MtlA by in-cell photo-crosslinking MS and deep learning

Browse structure collections

About this viewer

MolViewer shows 1J6T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.