2FEW: PTS system mannitol-specific EIICBA component

Name: PDB 2FEW: Complex of enzyme IIAMTL and phosphorylated enzyme IIBMTL from Escherichia coli NMR, restrained regularized mean structure
Published: 2006-02-07
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transferase

Complex of enzyme IIAMTL and phosphorylated enzyme IIBMTL from Escherichia coli NMR, restrained regularized mean structure. Determined by solution NMR. Released 7 Feb 2006.

Method: Solution NMR
Organisms: Escherichia coli, Escherichia coli O157:H7
Chains: 2
Atoms: 1,852
Mol. weight: 27.37 kDa
Released: 7 Feb 2006

Explore 2FEW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

2FEW contains 11 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	9-11	3
β-strand	12-13	2	1
α-helix	21-34	14
β-strand	38	1	2
α-helix	41-52	12
β-strand	56	1	1
β-strand	61-62	2	1
α-helix	68-73	6
β-strand	74	1	2
β-strand	78-89	12	1
β-strand	97-105	9	1
α-helix	107-109	3
α-helix	111-121	11
α-helix	125-133	9
α-helix	137-144	8

Chain B: 3 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	379-384	6	3
α-helix	390-404	15
β-strand	411-416	6	3
β-strand	426-430	5	3
α-helix	431-440	10
β-strand	445-449	5	3
α-helix	455-470	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
PTS system mannitol-specific EIICBA component	A	protein	148	Escherichia coli	P00550 (AlphaFold model)
mannitol-specific PTS system enzyme IIABC components	B	protein	101	Escherichia coli O157:H7	P00550 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>2FEW_1 PTS system mannitol-specific EIICBA component (chains A)
MANLFKLGAENIFLGRKAATKEEAIRFAGEQLVKGGYVEPEYVQAMLDREKLTPTYLGES
IAVPQGTVEAKDRVLKTGVVFCQYPEGVRFGEEEDDIARLVIGIAARNNEHIQVITSLTN
ALDDESVIERLAHTTSVDEVLELLAGRK

Sequence of entity 2 (B), FASTA

>2FEW_2 mannitol-specific PTS system enzyme IIABC components (chains B)
SHVRKIIVASDAGMGSSAMGAGVLRKKIQDAGLSQISVTNSAINNLPPDVDLVITHRDLT
ERAMRQVPQAQHISLTNFLDSGLYTSLTERLVAAQRHTENE

Primary citation

Solution Structure of a Post-transition State Analog of the Phosphotransfer Reaction between the A and B Cytoplasmic Domains of the Mannitol Transporter IIMannitol of the Escherichia coli Phosphotransferase System. Suh, J.Y., Cai, M., Williams Jr., D.C. et al. J Biol Chem (2006) 281:8939-8949. DOI 10.1074/jbc.M513466200 · PubMed

Other PDB entries of the same protein (UniProt P00550 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1A3A 1.8 Å, Crystal structure of iia mannitol from escherichia coli
1J6T Complex of enzyme iiamtl and the histidine-containing phosphocarrier protein hpr from…
1VKR Structure of iib domain of the mannitol-specific permease enzyme II
1VRV Structure of phosphorylated IIB (C384(SEP)) domain of the mannitol-specific permease…
9A2W Model of E. coli MtlA by in-cell photo-crosslinking MS and deep learning

Browse structure collections

About this viewer

MolViewer shows 2FEW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.