1ACI: L11 ribosomal protein

Name: PDB 1ACI: L11 ribosomal protein RNA binding domain, NMR, 20 structures
Published: 1998-01-14
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ribosomal protein

L11 ribosomal protein RNA binding domain, NMR, 20 structures. Determined by solution NMR. Released 14 Jan 1998.

Method: Solution NMR
Organism: Geobacillus stearothermophilus
Chains: 1
Atoms: 566
Mol. weight: 8.15 kDa
Released: 14 Jan 1998

Explore 1ACI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ACI contains 3 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	10-17	8
β-strand	34-35	2	1
α-helix	38-46	9
α-helix	57-69	13
β-strand	73-74	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
L11 ribosomal protein	A	protein	76	Geobacillus stearothermophilus	P56210 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1ACI_1 L11 RIBOSOMAL PROTEIN (chains A)
MTFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDLNAASIEAAM
RMIEGTARSMGIVVED

Primary citation

Cooperative interactions of RNA and thiostrepton antibiotic with two domains of ribosomal protein L11. Xing, Y., Draper, D.E. Biochemistry (1996) 35:1581-1588. DOI 10.1021/bi952132o · PubMed

Other PDB entries of the same protein (UniProt P56210 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1HC8 2.8 Å, Crystal structure of a conserved ribosomal protein-RNA complex
1QA6 2.8 Å, Crystal structure of a conserved ribosomal protein-RNA complex
1Y39 2.8 Å, Co-evolution of protein and RNA structures within a highly conserved ribosomal domain
1C04 5.0 Å, Identification of known protein and RNA structures in a 5 a map of the large ribosomal…
1FOW NMR structure of L11-C76, the C-terminal domain of 50S ribosomal protein L11, minimized…
1FOX NMR structure of L11-C76, the C-terminal domain of 50S ribosomal protein L11, 33…
1FOY The RNA binding domain of ribosomal protein L11: three-dimensional structure of the…
2FOW The RNA binding domain of ribosomal protein L11: three-dimensional structure of the…

Browse structure collections

About this viewer

MolViewer shows 1ACI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.